SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016835 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016835
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily vWA-like 1.41e-57
Family Integrin A (or I) domain 0.000000776
Further Details:      
 
Domain Number 2 Region: 179-266
Classification Level Classification E-value
Superfamily Integrin domains 4.18e-23
Family Integrin domains 0.00039
Further Details:      
 
Domain Number 3 Region: 430-513
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-19
Family Integrin beta tail domain 0.00085
Further Details:      
 
Domain Number 4 Region: 388-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Integrin beta EGF-like domains 0.0021
Further Details:      
 
Domain Number 5 Region: 346-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016835
Domain Number - Region: 314-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Integrin beta EGF-like domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016835   Gene: ENSSSCG00000015886   Transcript: ENSSSCT00000017298
Sequence length 596
Comment pep:known chromosome:Sscrofa10.2:15:74181045:74245447:-1 gene:ENSSSCG00000015886 transcript:ENSSSCT00000017298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISSSCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVC
KEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTI
GQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGVLQKDSGNILQLIISAYEELR
SEVELEVLGDTEGLNLSFTAICNNGTPFPHQKKCSHMKVGDTASFNMTVGIPNCEKRSRH
VIVKPVGLGDALEILISPECSCDCQKEVEVNSSKCNHGNGSFQCGVCACNPGHMGPHCEC
GEDTLSMDSCREAPEHLSCSGRGDCYCGQCTCHLSPYGNIYGPYCQCDDFSCVRHKGLLC
GDNGDCECGECVCRSGWTGEYCNCTTSTDQCVSEDGVLCSGRGDCVCGKCICTNPGASGL
TCERCPTCGDPCNSKRSCIECHLSADGQAREDCVDKCKLAGATISEEEDFSKDSAVSCSL
QGENDCLITFLITTDNEGKTIIHSISEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKL
LVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSMDG
Download sequence
Identical sequences ENSSSCP00000016835 9823.ENSSSCP00000016835 ENSSSCP00000016835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]