SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017077 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017077
Domain Number 1 Region: 342-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000305
Family Laminin G-like module 0.059
Further Details:      
 
Domain Number 2 Region: 42-218,260-338,703-828,877-899,927-988
Classification Level Classification E-value
Superfamily ARM repeat 0.000000995
Family HspBP1 domain 0.091
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017077
Domain Number - Region: 532-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0538
Family Pentraxin (pentaxin) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017077   Gene: ENSSSCG00000016118   Transcript: ENSSSCT00000017549
Sequence length 1068
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:118048753:118087143:-1 gene:ENSSSCG00000016118 transcript:ENSSSCT00000017549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKNALQAISPATMEVLMRVLADCDSWEDGNPEEVGRKVELTLKCLTEVVHILLTSSSDQR
QVETSSILENYFKLLNSDHSALPNQRRSRQWESRFIALQIKMLNTITAMLDCTDRPVLQA
IFLNSNCFEHLIRLLQNCKVFQGQLDCLAVSAIQALTAVMNKSPAAKEVFKERIGYTHMF
EVLKSLGQPPLELLKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPEIESHDLQIFIS
DWLKRICCINRQSRTTCVNANMGIRIIETLDSHSSLHRTCAENLIALHGSLGSQSVSSEE
IRQLLRLLRVDEPEYIHPYITPVTRAILTMARKQSLESALQYFNLSHSMAGISVPSIQKW
PGSAFSFNAWFCLDQDQLTLGSANKGGKRKQLYSFFTGSGMGFEAFITHSGTLVVAVCTK
REYATVMLPDHSFCDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKVYAPLRFPAMNEPF
ISCCIGSAGQRTTTPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGTVEKSKLITKLIS
AGTQDSEWGCPTSLEGQLGSVIIFSEALQPPQVKALYLAGPNCLSPWKFQESDMADLPAN
VLLHYTAKACKNSICLDLSTNCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLMEQIPLL
EFGEGQIPEGPRENTVSELITPVEGDWVVLTSTKASESRLERNLIATFILIVKHFIQRHP
INQDNLIHSHGVAVLGALLQKVPSTLMDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLF
DFRIWNRGDFPFRIGHIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGSDCKYNELSLD
DIRTIRTSLYGLIKYFLCKGGTHEEIQSIVGYIAAISEEEQLIGILDILFSLLHTSPTRG
QLFLLLFEPGNADILYALLLNQKYSDRLREIIFKVMEQMLKCTNVYERSKQRIRLREVGY
SGLGLLLNEAPVNTSLIKSLTNQIINTVIDPAINFKDLLSVVYISHRACVNVRVVICRKI
LQTLQSQPDAAHQISQQVGWQDTLVRLFLKANFENGNTPHKHIRTILM
Download sequence
Identical sequences ENSSSCP00000017077 ENSSSCP00000017077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]