SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017086 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017086
Domain Number 1 Region: 258-675
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.33e-94
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00046
Further Details:      
 
Domain Number 2 Region: 120-256
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.01e-37
Family Ferredoxin domains from multidomain proteins 0.00023
Further Details:      
 
Domain Number 3 Region: 47-119
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.71e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017086   Gene: ENSSSCG00000016127   Transcript: ENSSSCT00000017559
Sequence length 742
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:120961661:120998378:-1 gene:ENSSSCG00000016127 transcript:ENSSSCT00000017559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIIPSLGLLSSLDNMLRIPVTRALIGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEP
GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTN
SEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNI
GPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDI
CPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEW
ISDKTRFAYDGLKRQRLTQPMIRNEKGLLTYTTWEDALSRVAGMLQSFQGNDVAAIAGGL
VDAEALVALKDLLNRVDSDSLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVILLVGT
NPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGNHPFSQI
LKEAKKPMVVLGSSALQRSDGTAILAAVSNIAQNIRLSSGVTGDWKVMNILHRIASQVAA
LDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPMADVILP
GAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRSR
LEEVSPNLVRYDDVEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQ
TMAKCVKAVTEGIQAVEEPSIC
Download sequence
Identical sequences ENSSSCP00000017086 ENSSSCP00000017086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]