SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017120 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017120
Domain Number 1 Region: 186-378
Classification Level Classification E-value
Superfamily L domain-like 2.69e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 576-690
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.55e-28
Family Protein kinases, catalytic subunit 0.00000305
Further Details:      
 
Domain Number 3 Region: 363-494
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.23e-22
Family Growth factor receptor domain 0.00000284
Further Details:      
 
Domain Number 4 Region: 47-192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.13e-19
Family Growth factor receptor domain 0.000000477
Further Details:      
 
Domain Number 5 Region: 2-68
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000397
Family L domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017120   Gene: ENSSSCG00000016160   Transcript: ENSSSCT00000017595
Sequence length 690
Comment pep:novel chromosome:Sscrofa10.2:15:126092555:126283983:-1 gene:ENSSSCG00000016160 transcript:ENSSSCT00000017595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEILNGGVYVDQNKFLCYTDTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWG
PTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACV
TQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENG
IKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYN
AIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQ
QGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAE
GMVCNHLCSNDGCWGPGPDQCLSCRRFSRGRTCIESCNLYDGEFREFENGSICVECDPQC
EKMEDGILTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADEDRECHPCHP
NCTQGCSGPTSHDCIYYLWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKS
IKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVP
EGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLM
PHGCLLDYVHEHKDNIGSQLLLNWCVQIAK
Download sequence
Identical sequences ENSSSCP00000017120 ENSSSCP00000017120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]