SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017138 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017138
Domain Number 1 Region: 179-258
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-25
Family Thyroglobulin type-1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 17-98
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-20
Family Growth factor receptor domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017138   Gene: ENSSSCG00000016178   Transcript: ENSSSCT00000017616
Sequence length 265
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118558.1:22943:34814:1 gene:ENSSSCG00000016178 transcript:ENSSSCT00000017616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTAVLLLLAACAGPVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCG
VYTERCAQGLRCLPRRTNEVPLEAGVEGAGSCICKEKQFRHQIFIERDSREHEEPTTSEM
AEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPPPHTSPELCTIR
XQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGICWCVDKY
GMKLPGMEYVDGDFQCPSLDMSQVE
Download sequence
Identical sequences ENSSSCP00000017138 ENSSSCP00000017138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]