SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017157 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017157
Domain Number 1 Region: 342-609,795-835,887-951
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.92e-78
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017157   Gene: ENSSSCG00000016194   Transcript: ENSSSCT00000017635
Sequence length 982
Comment pep:known chromosome:Sscrofa10.2:15:133512791:133595116:-1 gene:ENSSSCG00000016194 transcript:ENSSSCT00000017635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLKIQGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLNAVAMKPSQGSGS
FGAILGSRTSQKETHRQLSYSDNQVSSKRGSLETKDDIPFRKVLGNPGRASIKTAAGSGI
TATRTIPSLTSTSTPLRSGLLENRTEKRKRMLSSGSELNEDYPKENDSSSNNKAMTDPSR
KYLTSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRAASKDYSPSSTNLDRTNISSQTPS
AKRSLGFLPQPAPLSVKKLRCNQDYTGWNKPRLPLSSHQQQLQGFSNLGNTCYMNAILQS
LFSLQSFANDLLKQGIPWKKIPLNALISRRFAHLLVKKDICNSETKKDLLKKVKNAISAT
AERFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVPGEENSPDVTATRVYTCPVIT
NLEFEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYS
CEKCGGKCALVRHKFNRLPRILILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTEN
TKPPFNLGWSAQMAISRPLKASQMVNSCITSPSTPSKNFTFKSKSSLALSLDSDSEDELK
RSVALSQRLCEISSSEQQQEDLEKDSKSCKLEPDKSELENSGFDAMSEEELLAAVLEISK
REASPSPSHEDDDKPTSSPDTGFAEDDIQEMPENPDPMETEKPKTITEPDPASFTEITKD
CDENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRAT
ELSLQEFNNSFLDSLGSDEDSGNEDVLDMEYTEAEAEELKRNAETGNLPHSYRLISVVSH
IGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEASVQSDRDRSGYIFFYMHKEIFDEL
LETEKNSQALSMEVGKTTRQAS
Download sequence
Identical sequences F1SRY5
9823.ENSSSCP00000017157 ENSSSCP00000017157 ENSSSCP00000017157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]