SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017277 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017277
Domain Number 1 Region: 100-159
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000235
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017277   Gene: ENSSSCG00000016306   Transcript: ENSSSCT00000017758
Sequence length 796
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:148362577:148418220:1 gene:ENSSSCG00000016306 transcript:ENSSSCT00000017758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILKAILLQKEESNQIPVDQLGQKLLKKKGVSWNKKYRKQYGPLRKFLQLHSQMFQLSSD
ERTVSLLKDRSLQAESDFQRSDQKTSTSESPGLNDRPSCPHWFDINDAKVQPIKEKDIEQ
QFQGKESAYMLFYRKSQLQRPPEARANPRYRVPCHLLNEMDAANIELQMKRAECDSTNNS
FELHLHLGPHYHFFNGALHPVVSQTESMWDLTFDKRKTLGDLRQSIFQLLNKWKVTKETC
VARDVALISVSFSLTRDDLTLCETEIADGEDIFVWNGVEVGGIQIPTGSDCEPLLLNVLH
LGTSSEGEESQQLVESPHVFPSNAELGTVFAALSVPEGVVLINSTTSLGEESWTALAKED
LKKTFREQGLRNGSTVLIQDSNDDSSFLTKQGKWITSTNEIDWLQVKNLCQLESEEEQVK
ISATLNTVVFDIRTKAIKELKLMKELAENSCLRPIDRKGKLLCPVPDSYTLKEAELKPGS
LLGLCPGKAPTSSQLFLFFAVGSDVQPGTEMEIIVEETVSVRGCLKIMLEKSGLSGFDFF
IGDTWHLRKMDWCFEAGEPLCEEDATLKELMICSGDTLLLIEGKLPPLGFLKVPIWWYQP
RGPWRHWHHQDQMDCTFAQGGNWRTNSTWCAPGDRQAEVSLHYLGDIEISEDATLGELKS
QALTLPNFSEFPVPSPAFLRAWTVEYKRPGRLLRVHQQQLKEYKLGKRTEICLEPLQKEE
HLGPQDVLLRTQMRLPGKRAYALPVDLVWDTARGWTAGSLRQRVANFCSLPVEKIEIAKY
FPEKFEWLPISSWNQQ
Download sequence
Identical sequences ENSSSCP00000017277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]