SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017355 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017355
Domain Number 1 Region: 1004-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-19
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 696-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000129
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 753-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000714
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 908-986
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000006
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000164
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 386-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 788-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000091
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 8 Region: 431-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000192
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 659-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 583-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 11 Region: 543-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000554
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 12 Region: 1310-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 620-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 14 Region: 351-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000875
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 472-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017355
Domain Number - Region: 507-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0175
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017355   Gene: ENSSSCG00000016381   Transcript: ENSSSCT00000017836
Sequence length 1414
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:154937360:154993020:1 gene:ENSSSCG00000016381 transcript:ENSSSCT00000017836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGATWALLLAAALGLGARGVRGAVALEDFYPFGAERGDAVTPKQDDGGSGLRPLSVLF
PFFGAEHSGLYVNNNGVISFLKEVSQFTPAAFPVARDRCVVAAFWADVDNRRAGDVYYRE
ATDAATLRRATGDIRRYFPELPGFSATWVFIATWHRVTFYGGSSSSPVNTFQTVLITDGR
LSFTIFNYETITWTTGTHASSGGNATGLGGIAAQAGFNAGDGRRYFSIPGSRTADVAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCSHTTSVCLALRPCLNGGKCIDDCVTGSPSYTCSCL
SGFTGRRCHLDVNECASHPCRNGGTCTSGVDSFSCQCPAGFGGHTCETAQLPCDAKECEN
GGWCQAEGGTAVCVCPAGYTGAACETDVDECRSGPCLNGGSCVDLLGNFSCLCAEPFQGP
RCETGKPPVSDACLSAPCQNGGTCVDADEGYVCECPEGFMGLHCRERTPQDCECRNGGRC
LGTNTTLCQCPPGFFGLLCEFEVTATPCNVNTQCPDGGYCMEYGGSYLCVCHTDHNISHA
LPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGRHCEKARPRLCSSGPCKNGGTCKEAGG
EYHCTCPYPFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCMNGGTCEDLGTDFSCRCQAGYTGRRCQAEVDCGPPEEVKHATLRFNGTRVGSVA
VYSCDRGYSLSASNRVRVCQPQGVWSEPPQCHEIDECRSQPCLHGGSCQDRVAGYLCVCR
PGHEGAHCELETDACRVQPCRNGGSCRGLRGAFVCQCPPGFTGVRCETEVDACHPSPCQH
GGRCENDGGAYLCVCPEGFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGFTGK
DCAKELFPPTALKVERVEESGLSISWRPPDSQAARQMLDGYAVTYASSDGSYRRTDVVDR
SRSSHQLRALAAGKAYNISVFSVKRNANNKNDISRPAVLLARTRPRPVEGLEVTNVTANA
ISVQWSLHRIRHATVSSVRVSIRHPEAQEEQSTDVDRSADKFTFGALLPGRRYAIWATAL
TGLGVQERPTESLASAPLHVWTRPLPPANLTAARVTATSAHVVWDAPAPGASLEAYVVNV
TSSQSTKSRSVPNGRLVSYTVRDLLPGRRYQLSVTAVQSTEGGPLHSEPAHLYIITSPRD
GADRRWHREGLPPRVLRNRPPPARLPELRLLNDHGALDTPTQAPRFSELVDGRGRVSAKW
GGSPGKRVTVRSQPTALVQLESAEEAPTQASLAFQLPDRSGDKDTDGAPGNCSENPCQNG
GTCVPGVDAHSCDCSPGFKGRRCELACRKVPQPCTRLFSETKAFPVWEGGVCHHVYKRVY
KVHPDTCFRESCESTRTRRTPDRKRSNSPTLEKS
Download sequence
Identical sequences ENSSSCP00000017355 ENSSSCP00000017355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]