SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017363 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017363
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.18e-29
Family Eukaryotic proteases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017363   Gene: ENSSSCG00000016388   Transcript: ENSSSCT00000017844
Sequence length 144
Comment pep:novel chromosome:Sscrofa10.2:15:155226088:155228788:1 gene:ENSSSCG00000016388 transcript:ENSSSCT00000017844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSTQLFEHTQHTLEMPVSQIVMHPDFEKLHPFGSDIAMLQLLFPVNFTSYIIPACLPA
PGLQLLNNASCWITGWGMLNEETPLPTPFHLQEAKVGLIENQFCNLVYGHRLSKNFSVYE
EMLCVGDFSTGKAICHVSEVISLL
Download sequence
Identical sequences ENSSSCP00000017363 ENSSSCP00000017363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]