SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017367 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017367
Domain Number 1 Region: 59-310
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.76e-76
Family Eukaryotic proteases 0.0000758
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017367   Gene: ENSSSCG00000016392   Transcript: ENSSSCT00000017848
Sequence length 367
Comment pep:novel chromosome:Sscrofa10.2:15:156766300:156781931:1 gene:ENSSSCG00000016392 transcript:ENSSSCT00000017848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSGPRCRICPMEIAGPGGSGAGWWGACTLAVVVLCLLSLPLGTEVAGTTTQRSTQPSEEC
GIPAVTGKIFGGRDAPQKRWPWQASVLYRGMHICGATIVSAYWVISAAHCFQKSHHPDDY
QILLGYYRLKSPTQHSLQMSVYRVFVHNDFNKRYFMGSDITLLQLYGPVNFTEYIRPACL
PGRNPQVSSSASCWITGWGMVTETTMLGDPYTLQEAQLGIMDSQICTMFFQGPQPGNNTY
SVQDDMLCAGDLMTGKSICRGDSGGPFVCNLNNVWFLIGLSSWSLPCQQPVSPSVFTRVS
YFSEWITQKQNSSPNPDPSSVPHPPSVPPGVPIFPSLGNIHKPRSVLTLVISQVLVLLLI
SLWTLQL
Download sequence
Identical sequences ENSSSCP00000017367 ENSSSCP00000017367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]