SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017394 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017394
Domain Number 1 Region: 38-193
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 4.71e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000426
Further Details:      
 
Domain Number 2 Region: 198-365
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.96e-38
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017394   Gene: ENSSSCG00000016416   Transcript: ENSSSCT00000017875
Sequence length 380
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:2664794:2673751:1 gene:ENSSSCG00000016416 transcript:ENSSSCT00000017875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLARCLLVMLISSLLLCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDEGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNNSAAWEPEALSGAGRPPGGAPG
RRALFASRVRPGQHVYVVAERGGDRRLLPAAVHSVTLREEATGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPF
Download sequence
Identical sequences ENSSSCP00000017394 ENSSSCP00000017394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]