SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017456 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017456
Domain Number 1 Region: 33-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-56
Family Ephrin receptor ligand binding domain 0.00000497
Further Details:      
 
Domain Number 2 Region: 639-847
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-46
Family Protein kinases, catalytic subunit 0.000000736
Further Details:      
 
Domain Number 3 Region: 359-566
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-33
Family Fibronectin type III 0.0000574
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017456
Domain Number - Region: 289-362,398-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000194
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017456   Gene: ENSSSCG00000016473   Transcript: ENSSSCT00000017937
Sequence length 847
Comment pep:novel chromosome:Sscrofa10.2:18:7652955:7658739:-1 gene:ENSSSCG00000016473 transcript:ENSSSCT00000017937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGPAPSGSGVAGMVCSLWVLVLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVA
GGTCRETFTLYYRQAEEPDGPDSISAWHLKRWTKVDTIAADESFPTSSAWAVGPRGAGPR
AGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYACPSVLRAFASFPETQASG
AGGASLVAAMGTCVAHAEPEEDGGGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPVR
GDKACQACPGGSYKALAANAPCSPCPARSHAPDPAAPVCPCLKGFYRATSDPPEAACTGP
PSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGAGGKGPCRRCRDEVHFDP
RQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQATAINVSTSHAVPSAVPAVH
QVSRAANSITVSWPQPDQTNGNILDYQLRYYDQAEDESRSFTLTSETNTATVTQLSPGHI
YGFQVRARTAAGHGPFGGKVYFQTLPQGELATQLPERLSLVIGSILGALAFLLLAAITVL
ALVFQRKRRGTGYMEQLQQYSSPGLGVKYYIDPSTYEDPCQALREFTREIDPTYVKIEEV
IGAGSFGEVRRGRLQPRGRREQPVAIQALWTGGAESLQMTFLGQAAVLGQFQHPNILRLE
GVVTKSRPLMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRA
LSAHSVLVNSHLVCKVARLGHTPQGPSCMLRWAAPEVIAHGKYTTSSDVWSFGIVMWEVM
SYGERPY
Download sequence
Identical sequences ENSSSCP00000017456 ENSSSCP00000017456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]