SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017458 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017458
Domain Number 1 Region: 32-131
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-21
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017458   Gene: ENSSSCG00000016475   Transcript: ENSSSCT00000017939
Sequence length 142
Comment pep:known chromosome:Sscrofa10.2:18:7724092:7744165:-1 gene:ENSSSCG00000016475 transcript:ENSSSCT00000017939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFLQRGVVRGQQLKMLVLLLLLGPTGYGFGALVSQHPGRAICKSGASVTIQCRTVDLQAI
TMFWYHQFPEQGPLLIATSDVGSNATYEKGYNSAKFLISHPDETFSSLVVRSVHPADSSL
YFCGASDTARSGILAQAPGSPS
Download sequence
Identical sequences ENSSSCP00000017458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]