SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017461 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017461
Domain Number 1 Region: 20-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.28e-88
Family Eukaryotic proteases 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017461   Gene: ENSSSCG00000016478   Transcript: ENSSSCT00000017942
Sequence length 247
Comment pep:known chromosome:Sscrofa10.2:18:7761371:7764639:-1 gene:ENSSSCG00000016478 transcript:ENSSSCT00000017942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPLLILACIGAAVAFPTDDDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGENNIDVLEGDEQFIDAAKIIRHPKYNSWTLDNDILLIKLSSPAVLN
SRVSTLALPSACAPAGTLCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGEIT
SNMVCAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKNRPGVYTKVCNYVDWIQ
QTIAANS
Download sequence
Identical sequences C6L245
ENSSSCP00000017461 NP_001193367.1.46622 9823.ENSSSCP00000017461 ENSSSCP00000017461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]