SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017469 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017469
Domain Number 1 Region: 243-413,448-615
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.37e-77
Family YicI catalytic domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 1108-1306,1350-1511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-75
Family YicI catalytic domain-like 0.00029
Further Details:      
 
Domain Number 3 Region: 11-242
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.53e-46
Family YicI N-terminal domain-like 0.0081
Further Details:      
 
Domain Number 4 Region: 860-1105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-44
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 5 Region: 1514-1594
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.22e-17
Family Putative glucosidase YicI, domain 3 0.0071
Further Details:      
 
Domain Number 6 Region: 618-698
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-16
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 7 Region: 832-881
Classification Level Classification E-value
Superfamily Trefoil 0.000000000277
Family Trefoil 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017469   Gene: ENSSSCG00000016487   Transcript: ENSSSCT00000017951
Sequence length 1739
Comment pep:novel chromosome:Sscrofa10.2:18:8049183:8132978:1 gene:ENSSSCG00000016487 transcript:ENSSSCT00000017951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCWKPVANTDIPWCFFPRNWGYEVSSWVKNTSTVLSAQLRRLPSPSLFGNDVIDTLFTAE
YQTSNRFHFKVTDFNNIRYEVPHESVRLFDDGAADTSNSSYHVEIVNKPFSVKIMRTSNQ
RVLLDTSIGPLQVAQQYLQLSFRLPSANVYGLGEHVHQQYRHSMAWRTWPIFTRDATPTQ
GMINLYGAHPFFLCLEDTSGYSFGVFLMNSNAMEVTLQPAPAITYRTTGGILDFYVFLGN
TPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGIDGLKKVVNRNRAAEIPYDVQYSDV
DYMDGKKDFTVDGVAFYNLSGFVRELHSYGLKYVIMMHPGIVNNSDYPPYVNGREKRVWI
LGNKGAVIGQGYPGWTVFPDFSNPACTEWWKDQFVEFNSTLEFDGVWIEMDEVSSFLQSP
DHECELNNLNFPPFTPRVVDRLLFARTLCMDAEFHEGLHYDVHSLYGYFMARATDRAMEA
ILSNKRGFILSRSTFAGSGTFAGHWLGDNAATWDDLRWSIPSILEFNLFGIPMVGANICG
YTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNSTLLNSARHYLNIRYTL
LPYLYTLFYRAHSLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYEGVDSAKA
YIPDAIWYDYETGVATQWRKQFVEMLLPGDRIGLHLRGGYIFPTQQPNTTTEASRRNSLG
LIIALDYKREAKGQLYWDDGILHYAVAQNKYILYDFSVTSNRLQAKIIKNTYTDPNGLTF
TNITILGMDKEPANFTVFLNNAATPISNVVYTSSTKVVSIPDLQGLLLGQEFSIEWNLPV
HDLQKFNCYPEEPAVSEENCQQRGCLWEPTTVPGVPTCFYDTIPNYAASNIQYLPTGITT
DLSHLTAPESAAPPSSRISFLRVSVIYHTATMLQFKIYDPTNKRYEVPVSLNTPPSPVGS
TADRLYDVRIQNNPFGIQIRRKSSGTVIWDSQLPGFTFNDLFLSISTRLPSQYLYGFGET
EHTTFRRNMSWHMWGMFARDEPPAYKKNSYGVHPYYMALEGDGNAHGVLLLNSNAMDVTF
QPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGQPAMVPYWALGFQLSRYGYQNDA
EISNLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIEQMKKNGMRFILILD
PAISGNETQYLTFTRGQENNVFIKWPDNSDIVWGKVWPDLPNVNVDGSLDPDTQVKLYRA
HVAFPDFLRNSTAAWWKKEIEELYRNPREPEKSLKFDGLWIDMNEPSNFVDGSVTGCSDD
VLNNPPYMPHLESRDGGLSNKTLCMESQQILPDGSPVRHYDVHSLYGWSQTRPTYEAVQE
VTGQRGVVITRSTFPSSGRWSGHWLGDNTAAWDQLRKSIIGMMEFSLFGVPYTGADICGF
FGDAEYEMCVRWMQLGAFYPFSRNHNTFGTRRQDPVAWNSTFEMFSRKVLQTRYALLPYL
YTLMHKAHVEGSTVVRPLLHEFTKDATTWDIDQQFMLGPAVLISPVLESNTFQILAYFPR
ARWYDYSTESGSESPGEWKILAAPLDHINLHIRGGYILPWQEPAMNTFSSRQKFMGLIVA
LDSSGRADGQIFWDDGQSIDTYENGNYFLANFTAAQNVLQIQTIHNKYLSDSNPLKVGYI
RIWGINSTYVTQVTLTYDNQQFVVMTFKSDPYNQTLTIQLTDKIISLEKLTEISWIHGG
Download sequence
Identical sequences ENSSSCP00000017469 ENSSSCP00000017469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]