SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017550 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000017550
Domain Number - Region: 45-142
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.000471
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017550   Gene: ENSSSCG00000016566   Transcript: ENSSSCT00000018036
Sequence length 301
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:20057527:20102918:-1 gene:ENSSSCG00000016566 transcript:ENSSSCT00000018036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQAL
RTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHLVPSQTVVQTFSNPDGTVSLIQV
GTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAV
ASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGAL
TGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPVTTRISDSAVTMDGQAVEVVTLE
Q
Download sequence
Identical sequences ENSSSCP00000017550 9823.ENSSSCP00000017550 ENSSSCP00000017550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]