SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017558 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017558
Domain Number 1 Region: 428-497
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000146
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 141-203
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000963
Family VWC domain 0.0046
Further Details:      
 
Domain Number 3 Region: 255-320
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000167
Family VWC domain 0.0089
Further Details:      
 
Domain Number 4 Region: 1096-1159
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000377
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 546-612
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000555
Family VWC domain 0.0087
Further Details:      
 
Domain Number 6 Region: 724-790
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000178
Family VWC domain 0.02
Further Details:      
 
Domain Number 7 Region: 843-908
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000377
Family VWC domain 0.017
Further Details:      
 
Domain Number 8 Region: 901-967
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000513
Family VWC domain 0.0078
Further Details:      
 
Domain Number 9 Region: 204-262
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000126
Family VWC domain 0.03
Further Details:      
 
Domain Number 10 Region: 374-435
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000366
Family VWC domain 0.0032
Further Details:      
 
Domain Number 11 Region: 313-372
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000471
Family VWC domain 0.086
Further Details:      
 
Domain Number 12 Region: 960-1035
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000534
Family VWC domain 0.01
Further Details:      
 
Domain Number 13 Region: 783-839
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000628
Family Fibronectin type I module 0.054
Further Details:      
 
Domain Number 14 Region: 487-549
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000105
Family VWC domain 0.029
Further Details:      
 
Domain Number 15 Region: 667-720
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000324
Family VWC domain 0.07
Further Details:      
 
Domain Number 16 Region: 1428-1493
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000147
Family ATI-like 0.054
Further Details:      
 
Domain Number 17 Region: 97-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family VWC domain 0.028
Further Details:      
 
Domain Number 18 Region: 1049-1094
Classification Level Classification E-value
Superfamily FnI-like domain 0.000022
Family VWC domain 0.0075
Further Details:      
 
Domain Number 19 Region: 627-673
Classification Level Classification E-value
Superfamily FnI-like domain 0.000023
Family VWC domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017558   Gene: ENSSSCG00000016574   Transcript: ENSSSCT00000018044
Sequence length 1517
Comment pep:known chromosome:Sscrofa10.2:18:20780751:20811231:1 gene:ENSSSCG00000016574 transcript:ENSSSCT00000018044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGATAALLPLVLQLMGLALAPGMGRGSVVPRETPGLADSRDYQPQALAYSSAPARAPQE
LWRPLEERLGRLEAEVTQLREQNQVLQGRVRQLESCECHPASPQCWGLGRAWPEGARWEP
DACTACVCQDGAARCDPKPGLPRCHGCSHNGQTYGNGETFSTDACTTCRCLAGTVRCQGP
SCSELNCLESYTPPGECCPVCRPGCTEGGSHQEHGQEWTTPGDPCRICQCLEGHIRCRQH
ECASLCPYPARPLPGTCCPVCDGCFLNGQEYRSGEPVGSGDPCSHCRCANGSVQCEPLPC
PATPCRYPGRIPGKCCPVCDGCEYQGHQYQSQETFRLQESGRCVHCTCQAGEVSCEEREC
PVAPCALPDSGPQLCPACVLDGEEFAEGVQWEPDGQPCMACSCQAGVPMCRALLCSPAPC
QHPTRPLGACCPSCESCTYHGQVYANGQNFTDADSPCHACRCEDGTVTCSLVNCPPTTCA
RPQRGPGQCCPRCPDCVLEKQVFVDGERFSHPRDPCQECQCQEGQAHCQPRVCPTASCAH
PLPGPCCQHNCNGCAFGGKEYPNGADFPHPSDPCRLCRCLSGNVQCLARRCPPLLCPEPA
MLPGKCCPQCPATPSSCPRPGSKVPAHHQEHFSPPDDPCHLCLCLDGSVSCQRLPCPPVP
CTHPRQGPCCPSCDGCQYQGKEFTSGERFPSPTARCHVCLCWEGSVRCEPRVCAPAQCPF
PARGDCCPTCDGCEYLGESYLSSQEFPDPRESCSRCTCLGGFVTCGRRPCEPLGCSHPLT
LPGHCCPTCQGCLYHGVTAAPGETLPDPLDPTCSLCTCQEGSMSCRKKPCPPALCPHPSP
GPCFCPVCHSCLSHGREHQDGETFEGPPGSCERCRCQAGQVSCARLPCPPLPCPLQVTEQ
GSCCPRCRGCLVRGEEHPEGSSWEPPDSPCSSCMCHEGVITCARIQCVTSCAQPRQGPSD
CCPRCSDCEHKGRKYEPGESFQPGADPCEVCICELQPEGPPSVRCHRRQCPSLVGCPASQ
LLPPGPQHCCPTCAQALSHCTEGLLGSELALPGPCYTCQCQDLTWLCIQRACPELSCPLL
ERHTPSGSCCPVCQAPAQSCLHQGQQVASGEHWAVDACTSCSCVAGTVRCHSQRCPLLFC
NPDEAPALNPGSCCPHCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGNFS
VHVTNDDRGRSGVSWTQEVAVLLGDVTVQLLQGRVVTVDGRPVALPSLREPLLYAELRGR
TVILHAQSGLQVLWDGQSQVEVRVPGSYRGQVCGLCGNFNGFAQDDLRGPEGMLLSTEAA
FGNSWQVPEGPGPGRPCSKGREVDPCRAAGYRARREANARCGVLKSSTFSRCHAVVPPEP
FFAACVYDLCACGLGSAADTCLCDVLEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFMF
DECGPPCPRTCFNQHVPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTGD
QLPSTLPSPSREPQGPP
Download sequence
Identical sequences ENSSSCP00000017558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]