SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017560 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017560
Domain Number 1 Region: 489-558
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000188
Family VWC domain 0.0052
Further Details:      
 
Domain Number 2 Region: 141-203
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000105
Family VWC domain 0.0046
Further Details:      
 
Domain Number 3 Region: 316-381
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000188
Family VWC domain 0.0089
Further Details:      
 
Domain Number 4 Region: 1157-1220
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000398
Family VWC domain 0.011
Further Details:      
 
Domain Number 5 Region: 607-673
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000555
Family VWC domain 0.0087
Further Details:      
 
Domain Number 6 Region: 204-262
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000103
Family VWC domain 0.01
Further Details:      
 
Domain Number 7 Region: 785-851
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000188
Family VWC domain 0.02
Further Details:      
 
Domain Number 8 Region: 904-969
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000046
Family VWC domain 0.017
Further Details:      
 
Domain Number 9 Region: 962-1028
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000555
Family VWC domain 0.0078
Further Details:      
 
Domain Number 10 Region: 548-609
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000251
Family VWC domain 0.029
Further Details:      
 
Domain Number 11 Region: 264-324
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000387
Family VWC domain 0.03
Further Details:      
 
Domain Number 12 Region: 1021-1096
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000555
Family VWC domain 0.01
Further Details:      
 
Domain Number 13 Region: 374-430
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000596
Family VWC domain 0.086
Further Details:      
 
Domain Number 14 Region: 844-900
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000816
Family Fibronectin type I module 0.054
Further Details:      
 
Domain Number 15 Region: 435-499
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000858
Family VWC domain 0.0032
Further Details:      
 
Domain Number 16 Region: 728-781
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000366
Family VWC domain 0.07
Further Details:      
 
Domain Number 17 Region: 1489-1554
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000155
Family ATI-like 0.054
Further Details:      
 
Domain Number 18 Region: 97-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family VWC domain 0.028
Further Details:      
 
Domain Number 19 Region: 1110-1155
Classification Level Classification E-value
Superfamily FnI-like domain 0.000023
Family VWC domain 0.0075
Further Details:      
 
Domain Number 20 Region: 688-734
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000241
Family VWC domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017560   Gene: ENSSSCG00000016574   Transcript: ENSSSCT00000018046
Sequence length 1578
Comment pep:known chromosome:Sscrofa10.2:18:20780751:20811231:1 gene:ENSSSCG00000016574 transcript:ENSSSCT00000018046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGATAALLPLVLQLMGLALAPGMGRGSVVPRETPGLADSRDYQPQALAYSSAPARAPQE
LWRPLEERLGRLEAEVTQLREQNQVLQGRVRQLESCECHPASPQCWGLGRAWPEGARWEP
DACTACVCQDGAARCDPKPGLPRCHGCSHNGQTYGNGETFSTDACTTCRCLAGTVRCQGP
SCSELNCLESYTPPGECCPVCRPGCEYEGQLYEEGANFPSSSNPCLQCSCLTSLVRCVPM
KCPPVPCPEPVLRPGHCCPTCQAQGCTEGGSHQEHGQEWTTPGDPCRICQCLEGHIRCRQ
HECASLCPYPARPLPGTCCPVCDGCFLNGQEYRSGEPVGSGDPCSHCRCANGSVQCEPLP
CPATPCRYPGRIPGKCCPVCDGCEYQGHQYQSQETFRLQESGRCVHCTCQAGEVSCEERE
CPVAPCALPDSGPQLCPACVLDGEEFAEGVQWEPDGQPCMACSCQAGVPMCRALLCSPAP
CQHPTRPLGACCPSCESCTYHGQVYANGQNFTDADSPCHACRCEDGTVTCSLVNCPPTTC
ARPQRGPGQCCPRCPDCVLEKQVFVDGERFSHPRDPCQECQCQEGQAHCQPRVCPTASCA
HPLPGPCCQHNCNGCAFGGKEYPNGADFPHPSDPCRLCRCLSGNVQCLARRCPPLLCPEP
AMLPGKCCPQCPATPSSCPRPGSKVPAHHQEHFSPPDDPCHLCLCLDGSVSCQRLPCPPV
PCTHPRQGPCCPSCDGCQYQGKEFTSGERFPSPTARCHVCLCWEGSVRCEPRVCAPAQCP
FPARGDCCPTCDGCEYLGESYLSSQEFPDPRESCSRCTCLGGFVTCGRRPCEPLGCSHPL
TLPGHCCPTCQGCLYHGVTAAPGETLPDPLDPTCSLCTCQEGSMSCRKKPCPPALCPHPS
PGPCFCPVCHSCLSHGREHQDGETFEGPPGSCERCRCQAGQVSCARLPCPPLPCPLQVTE
QGSCCPRCRGCLVRGEEHPEGSSWEPPDSPCSSCMCHEGVITCARIQCVTSCAQPRQGPS
DCCPRCSDCEHKGRKYEPGESFQPGADPCEVCICELQPEGPPSVRCHRRQCPSLVGCPAS
QLLPPGPQHCCPTCAQALSHCTEGLLGSELALPGPCYTCQCQDLTWLCIQRACPELSCPL
LERHTPSGSCCPVCQAPAQSCLHQGQQVASGEHWAVDACTSCSCVAGTVRCHSQRCPLLF
CNPDEAPALNPGSCCPHCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCRGGNF
SVHVTNDDRGRSGVSWTQEVAVLLGDVTVQLLQGRVVTVDGRPVALPSLREPLLYAELRG
RTVILHAQSGLQVLWDGQSQVEVRVPGSYRGQVCGLCGNFNGFAQDDLRGPEGMLLSTEA
AFGNSWQVPEGPGPGRPCSKGREVDPCRAAGYRARREANARCGVLKSSTFSRCHAVVPPE
PFFAACVYDLCACGLGSAADTCLCDVLEAYASHCRQAGVTPAWRGPTLCVVGCPLDRGFM
FDECGPPCPRTCFNQHVPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTG
DQLPSTLPSPSREPQGPP
Download sequence
Identical sequences ENSSSCP00000017560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]