SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017654 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017654
Domain Number 1 Region: 85-154
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000136
Family VWC domain 0.02
Further Details:      
 
Domain Number 2 Region: 211-287
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000241
Family VWC domain 0.022
Further Details:      
 
Domain Number 3 Region: 554-611
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000507
Family BSTI 0.047
Further Details:      
 
Domain Number 4 Region: 27-93
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000356
Family VWC domain 0.006
Further Details:      
 
Domain Number 5 Region: 164-218
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000711
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017654   Gene: ENSSSCG00000016665   Transcript: ENSSSCT00000018144
Sequence length 613
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:43218004:43462084:-1 gene:ENSSSCG00000016665 transcript:ENSSSCT00000018144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTYAGNTYNSSFKWQSPTEPCILRQ
CQEGVVTESAVRCVVHCKNPSKHLGTCCPTCPGCVFEGVQYREGEEFQPEGDKCTKCSCV
EGRTQCLREVCPILSCPQHLSHIPPGQCCPRCLGQRKVFDLPFGSCLFRSDVYDNGSSFL
YDNCTACTCRDSTVVCKKKCSQPGGCDRGEGACCEECLLRVPSEDIKMCKFGNKIFRDGE
MWSSINCTICACVKGQTECRKKQCVPISSCPQGKILNRKGCCPICTEKPGVCTVFGDPHY
NTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKSVDLVLGTSTVSL
QQHLTVRWNGSRIALPCQAPQFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLKGK
LCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTVRV
KLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCESFLAYTRACQRE
GISVHWEPQQTCAATQCKHGAVYDTCGPGCVKTCDNWNEIGPCNKPCVAGCHCPANLVLH
KGRCIKPVLCPQR
Download sequence
Identical sequences ENSSSCP00000017654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]