SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017718 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017718
Domain Number 1 Region: 143-260
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.53e-26
Family Thyroglobulin type-1 domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 30-113
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-20
Family Growth factor receptor domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017718   Gene: ENSSSCG00000016728   Transcript: ENSSSCT00000018209
Sequence length 263
Comment pep:known chromosome:Sscrofa10.2:18:54861845:54866804:-1 gene:ENSSSCG00000016728 transcript:ENSSSCT00000018209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEVPAVRAWPLLLSLALQLGAAAGAPQPWHCAPCSAERLALCPPVPASCPEATRPAGCG
CCPTCALPLGAACGVATARCARGLSCRALPGEPRPLHALTRGQGACMPAPSAEATETKDP
AAPETTSPESTEMTQEQLLDSFHLMATSSEDLPILWNAINNYESMKALEATDIKKWKEPC
QRELYKVLDRLAREQQKAGDRLYKFYLPNCNKNGFYHSKQCETSLEGEPGLCWCVYPWSG
KKILGSTAVRGDPKCHQYFNSQN
Download sequence
Identical sequences E0A8P1
NP_001182034.1.46622 9823.ENSSSCP00000017718 ENSSSCP00000017718 ENSSSCP00000017718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]