SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017719 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017719
Domain Number 1 Region: 112-157
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000017
Family Thyroglobulin type-1 domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017719
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017719   Gene: ENSSSCG00000016729   Transcript: ENSSSCT00000018210
Sequence length 157
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:54851504:54856012:1 gene:ENSSSCG00000016729 transcript:ENSSSCT00000018210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQPPPGEPRPLQALLDGRGICANASAAGRLRAYLLPAPPAPGNGSESEEDRSVDSMENQA
LPSTHRVPDSKLHSVHTKMDVIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPC
RREMEDTLNHLKFLNMLSPRGIHIPNCDKKGFYKKKQ
Download sequence
Identical sequences ENSSSCP00000017719 ENSSSCP00000017719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]