SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017825 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017825
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily DNA clamp 3.45e-18
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017825
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00974
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017825   Gene: ENSSSCG00000016826   Transcript: ENSSSCT00000018321
Sequence length 281
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:21405694:21414047:-1 gene:ENSSSCG00000016826 transcript:ENSSSCT00000018321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQIPDESDYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQA
NAFIQAGIFQEFTVQEESVTFRINLTVLLDCLSIFGSSPVPGTLTALRMCYQGYGYPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITM
SPDKPYFRLSTFGNAGSSHLDYPKDSDLMESFHCNQTQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences F1SND5
ENSSSCP00000017825 XP_003133926.1.46622 XP_013840189.1.46622 9823.ENSSSCP00000017825 ENSSSCP00000017825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]