SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017860 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017860
Domain Number 1 Region: 75-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000123
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 14-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000419
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017860
Domain Number - Region: 147-253
Classification Level Classification E-value
Superfamily Superantigen MAM 0.0745
Family Superantigen MAM 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017860   Gene: ENSSSCG00000016856   Transcript: ENSSSCT00000018356
Sequence length 453
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:25800221:25823336:-1 gene:ENSSSCG00000016856 transcript:ENSSSCT00000018356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPKPVDCNGTPSPIDCRMSPWGEWSRCDPCLKQMFRSRSIETFGQFNGQKCVDAVGDRRQ
CVPTEPCEDLEEDCGSDFQCGTGRCIKRRLLCNGDNDCGDFSDEDDCDSDPRPPCRERVV
EESELARTAGYGINILGMDPLTTPFDNEYYNGLCDRVRDGNTLTYYRKPWNVAALIYETK
VDKNFRTEYHERQIQVLKTIIEEKKSNFNADLTIKFTPTEAIEQLKSKNVELANEENSNP
MNNKAHFRFTYSKTETYKLLLSYSSKKEKIFLHVKGVIHLGRFVMRKRDVMLTKTFLDDV
KYLPSTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKATMTEKGIELRDVHRCLGF
NLDLSLNFGVEIKGKIDSENCLKRGDGKTENIMNDDFIDDVISFIRGGTRKYATELKELL
KGAKMINVTDFVNWASSLNDAPVLINQKVSNVY
Download sequence
Identical sequences ENSSSCP00000017860 ENSSSCP00000017860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]