SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017865 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017865
Domain Number 1 Region: 570-636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017865
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00239
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017865   Gene: ENSSSCG00000016859   Transcript: ENSSSCT00000018361
Sequence length 843
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:27054738:27112719:-1 gene:ENSSSCG00000016859 transcript:ENSSSCT00000018361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAMSLVFLVGLIGEFQVFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRPVAVYGQYGG
HPCVGSTFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCEEDSADEDRCE
DSESRPSCDLSKPPPNIELTGNGYNALTGQFRNRVLNTKSFGGQCRKVFSGDGRDFYRLS
GNVLSYTFQVKVNNDFNYEFYNSTWSYAKHTSTEHTSSSKGRVFIFSSSSSSSSYYAKTY
EILKKKSYQLLVVQNTVEVAQFINNNPEFLQLAESFWKELSYLPPLYDYSAYRKLIEQYG
THYLQSGSLGGEYKVLFYVDSEKVAESDLSSEDKKKCASSHISFLFKSSKHKCKAMEEAL
KSASGTQSNVLRGVPFVRGGRPGFVSGLSYLELDNPDGNKQRYSSWAGSVTDLPQVIKQK
LTPLYELVKEVPCASVKRLYLKRALEEYLDEFDSCHCQPCQNGGMASVEGTQCQCHCKPN
TFGVACEQGVLVGDHAGGIDGGWSCWSSWGPCAQGKKTRSRKCNNPPPSGGGKSCIGETS
ESRQCEDEDLEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQNEETTFPVGKNIVYSCN
EGYSLVGDPVARCGEDLQWTVGKMHCQKIACVLPTLMRGLQSHPQKPFYTVGEKVTFSCS
SGMSLEGPSTFLCGSSLKWSPEMKNVQCVRKEAPLAKKVPECQLWEKLQNSKCVCKMPYE
CGSSLDVCARDERSKRILRLTVCKMHVLQCQGRNYTLSVGETCTLPGSAEKACGACPLWE
KCDAQSSKCVCRAASECEEAGFRVCVEVNGREQTMTECEAGVLRCLGLSITVTSIRPCAP
EAP
Download sequence
Identical sequences ENSSSCP00000017865 ENSSSCP00000017865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]