SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017868 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017868
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000459
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 698-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000031
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017868
Domain Number - Region: 516-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 237-327
Classification Level Classification E-value
Superfamily YppE-like 0.0471
Family YppE-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017868   Gene: ENSSSCG00000016861   Transcript: ENSSSCT00000018364
Sequence length 766
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:27210756:27269057:-1 gene:ENSSSCG00000016861 transcript:ENSSSCT00000018364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRHSVLYFILLSGLIDKSQACFCDHYPWTQWSSCSKTCNSGTQTRQRQITINQYYLDNF
CDRLCTKQETRECNWQTCPINCLLGDYGPWSDCDPCVEKQFKVRSILHPNQFGGQPCTEP
LMTFRPCIPSKLCKIEEVDCKNKFRCDSGRCIASKLECNGENDCGDNSDERNCGRTKAVC
SRKYNPIPSVQLMGAGFHILAGEPRGEVLGNSFTGGICKTVKSSKASNPFRVPANLENVD
FEVQTKEDDFETDFYEDLIPLENSKDQQATGFGQEKSSFHVPIFYSSKKSQTSSHNSAFK
QAIQASHKKDSSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNAALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSNEELKNSGLTQEEAKNCIRIETKKRYFIVTKTKVEHRC
TTNRMSEKYEGSFLQGSEKSISLVKGGRSEYAAALAWEKGSSGPGEKTYSEWLESVKENP
AVIDFELAPITDLVRNIPCAVTRRNNLRRAFREYAAKFDPCQCAPCPNNGRPVLSGTECL
CVCQSGTYGDNCERRAPDYKSNAVDGNWGCWSSWSTCDATYKRSRTRECNNPAPRQGGKP
CEGERRQEEHCTFSIMQNTGQPCIGDDEDMKEIDLPEIESDSGCPQPVPPENGFIRNEKT
LYSVGEDVEIVCLTGFKTVGYQYFRCLPDRTWRRGDVECQRTDCLLPVVPEVLKLSPFQR
LYKIGDSIELSCPKGFVIAGPSRYTCSGDSWTPPISSSLTCEQVFL
Download sequence
Identical sequences ENSSSCP00000017868 ENSSSCP00000017868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]