SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017896 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017896
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.14e-45
Family Molybdopterin synthase subunit MoaE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017896   Gene: ENSSSCG00000016888   Transcript: ENSSSCT00000018392
Sequence length 192
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:34269654:34290773:-1 gene:ENSSSCG00000016888 transcript:ENSSSCT00000018392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCCNQEMKLPLSPPLVEGSAFVPPGKDMNEVEEKSKDIIKFTSEKLSIDEAS
QLVISPVCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVRHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDNLKAKVPIWKKEMYEESPSSWKRN
KECFWATSDSTT
Download sequence
Identical sequences F1SMF3
9823.ENSSSCP00000017896 ENSSSCP00000017896 ENSSSCP00000017896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]