SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017907 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017907
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-28
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 2 Region: 187-364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-26
Family Laminin G-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017907   Gene: ENSSSCG00000016898   Transcript: ENSSSCT00000018403
Sequence length 2307
Comment pep:known chromosome:Sscrofa10.2:16:36127284:36204033:-1 gene:ENSSSCG00000016898 transcript:ENSSSCT00000018403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPASFYGESYVELSITEVSSELSLQLTFQTSKPQGLLFLAAGKSDYFIIELLAGNLRVRV
NLGAGEQVLLSEQRLRMDDLVWHFVELFCVKDSISLVIDKHYEMTGQITGGRHSLHFQHG
IYIAGHGGLDVPYLDGELPNFRGCMEDVVFNQREILTSLRSYPGFKKVYEVSLGCSDEFF
AGEDEAINFFSSRSYVAFPEWKMPGHGLLEFALQTETQQALLLFQSGQEGDFIALEIAKG
LLKAHVGRNKNNTELSSFSLVSDNQWHVIQFKFTERYLDLMVDEQGVRTLLPLQSQPFVS
EGPLFVGGLGNHKGEEVKRLQLAFVPRKSARGLSFKGCIRGLEANSKKRALKDALLSKDI
AAGCKMKSSDNENPSVTIRENLLRAEIPLSTAVPEAGQPILQDGSRYFLVLNNLEVQEGG
RALLEQRHMNVDVDLEDLGIRQSQILFKIQEIPVHGFLQLDVSPEQDTEKAFSLLDLEQG
KVWYVHNGSEEPMDYFTFSVFFSSKEEMPLYQQGQVSYVFNIIVIPVNDPPNLKLPEGSL
LLVFENSKKQLTPSIIHVSDPDTDSLSLSFSVLGNFNSDAGFLENTNDPGRPTAGFTYGD
LRDGNIFYVHRGHQHSRILLRATDGEVVSNTVVLRVMAVPWDFEIANSTGVAVEQGGTAL
ITQGHLSVEVNGERPEVETRYLITHPPQFGQIQRQGSSGEWKQISTFSQRSVDRGRVRYC
STFKDLQLENVTDHFKFRVNIEGKSSEELTFPVTVQWLRFTLLKNVPLEISKINRHILNS
DHLQAVTEGMEVAERELQFKLLTTPKKGKLLLGTHVLKANSVFSQQNITDSKISYEPQER
PREHSQDTFKFLMVAKHIESKDYTFRIRFKAEKKHIILTNRGLFVKEGEGKVITKSELFA
QTLDSQTFQYKVTKSPQHGKLKLIHSSDSPGVHDNITTFTDQDILGEWLMYVHDDSETEY
DEFLLVASTTGPGPEGVVGDGGTERLSAEMKVTVSVGLKNDEKPVRVVDKVFDVVRNGQR
LLTLADLCYHDPDSDFDDGQLLYTRRGIPNGDLVRASDPTQKLYQFRQNDLREGRVLFRH
WGADSARFVLFVTDGVHYTSSLLEISVSEPYVRVVNNTGLLVQRGEESSLTTANLSVTTN
QDVRTDHEIEFHILQPPKHGIVLVNSSGQGRFSLHDLKQGHVTYRHGGRSSFDVFNLTVK
VKDVELELGVYVRVDSESHKHHAQILHSKTLVVEEGKPVKLSRGRLQAVHEGNFPSEATF
IVKALPKHGYLRRSLSEEGSLGANEKSPLTFTQQDINDGYIHYVQTAPDQQLDRFLLDVV
NGFQAVSRVEILVDIIPKWIPLEVQNFTVQEGGSKALLEDHFKIPSKHFERLDCEFVLLK
PPKHGYIENSHFPRVELMKFTRKQVENGLISYVHDDSEDLLDSFTIFANSSELGKQSVPQ
TLFVTVKSVNDEAPVITANKILQVWVNSVTEITSGDLCAEDADSSPRDLAYLVSPPSNGH
LALKSFPGHSIQNFTQAEVNEGQLVFVHTGAMSGGFNFQVSDGLNFAAGQIFSITARALV
LSLEVNRGLSIFPGSIKPLSSCDLRAVTNDVDSAGNRTITFTVVSSPRLGRLVRVNSDNS
TEDVSVFTQNLVSEQLILYQHVDWENTGWTAEDSFMFTASSPPADLGPEEFHITISYEIN
EPGRQSRLLANTGAVVKEGDKVLIDQSKLDASNLLFKLPKSQRSSYEIWFQVTSLPHHGS
IMVGERNITQRKPNFSQYIINKFGITYLHDDSESLADNFTFAVWPNQKSKSTTKPEADFL
EEMFNITISPVNDQAPELKTKGLRLKVLQGSRLVLGPENLKVEDEDSPPEEIRYTVIHNP
DNGFLAMAHHLDTPVHHFTQADIDDSQVWFMQDGSPSSGVFYFSVTDGQHRPLYKLFHLD
VIPISITLVNLTDLLLPQGQTTIPITSAHLSAMTNGRSPQITYRITRPLQHGYLLFENQV
VISFGQEELDSGKLSYHMTNLTASEDQLQFSLFTSESNLTGQTLSIRVQPLLWVTSNLTV
SNRVAHRLRRKDLDATELANRTNSDPEFEVTDPPIHSRLLRRVGQATVMEDTTLFTQRDV
DQGLLMLEPHANLTGTDWLNDSFTFLLRADRVQPAIGCLPFTIVPPDPFFSQTFTPDVSL
LVTADNLVTAGLSQEKASPTRAIWPPDATKASAGTPTLPRESGHYSLMVIVPLTAVIFLL
IVTSVALCVWLLGCKVEKAKPLIKLQTNLEPTTPGARPERSTTIPTVTVTPLLKSSSSPP
PWVNLDPDMVKLCRQTNPTLKHNQYWV
Download sequence
Identical sequences ENSSSCP00000017907 ENSSSCP00000017907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]