SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017908 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017908
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000753
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017908   Gene: ENSSSCG00000016900   Transcript: ENSSSCT00000018405
Sequence length 183
Comment pep:novel chromosome:Sscrofa10.2:16:36289025:36296446:-1 gene:ENSSSCG00000016900 transcript:ENSSSCT00000018405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLATLLVPAHLAAAWSTKYAVDCPERCDTNECKSSLRCKRTVLDDCGCCRVCAAG
LGETCYRTVSGMDGVKCGPGLRCQFYSEEDDFGDEFGICKDCPYGTFGMECKQTCSCQSG
ICDRVTGKCLKFPFQYSVAKAANRRFVSHTEHDMASGDGNAVREELMKENAARSPGMKWL
NPR
Download sequence
Identical sequences F1SLP7
9823.ENSSSCP00000017908 ENSSSCP00000017908 ENSSSCP00000017908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]