SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017911 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017911
Domain Number 1 Region: 25-255
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.17e-59
Family Eukaryotic proteases 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017911   Gene: ENSSSCG00000016902   Transcript: ENSSSCT00000018408
Sequence length 258
Comment pep:known chromosome:Sscrofa10.2:16:36365989:36376137:1 gene:ENSSSCG00000016902 transcript:ENSSSCT00000018408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPFPFFFPAAMCLLIIPGVFPVSCDGIIGGNEVSPHTRRYMALIEGLKVCAGALIKEN
WVLTAAHCDLKGNPQVILGAHSTSHKEKYDQTFSIKKAIPYPCFDPQTFEGDLQLLQLEG
KATMTKAVGILKLPNTGKDVEPHTKCHVAGWGSTRKDSCKISNTLREVNITVIDRKMCND
AQHYNFNPVIDLGMICAVGRKGEDDSCEGDSGSPLICDNIFRGVTSFGKCGNPQKPGVYI
LLTKKHLNWIKKTIAGAI
Download sequence
Identical sequences F1SLN5
ENSSSCP00000017910 ENSSSCP00000017911 9823.ENSSSCP00000017911 ENSSSCP00000017910 ENSSSCP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]