SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017912 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017912
Domain Number 1 Region: 28-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.85e-66
Family Eukaryotic proteases 0.0000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017912   Gene: ENSSSCG00000016903   Transcript: ENSSSCT00000018409
Sequence length 259
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:36385658:36393941:1 gene:ENSSSCG00000016903 transcript:ENSSSCT00000018409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNSSTFLAATLSIVIFLQIHEDFCVEIIGGNPVTPHSRPYMVLLEGKNICAGALIAKDW
VLTAAHCALNKKSQIILGAHSITKKEPEKQIMLVKKEYPYPCFDQDTHEGDLKLLKLNKK
ATLNKNVAVLHLPKVGDDVKPGTVCRVAGWGKFHNNSPRSDILREVNVTVIDRKICNDKS
HYNYTTVIGLNMICAGSPQGGKDSCNGDSGAPLICEGIFRGVTAFGLSEKCGDPRGPGVY
ILLSKKHLNWIVNTMKHAV
Download sequence
Identical sequences F1SLN4
ENSSSCP00000017912 ENSSSCP00000017912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]