SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017951 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017951
Domain Number 1 Region: 93-313
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.1e-58
Family Reprolysin-like 0.0005
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000222
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 688-745
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 749-805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 863-914
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 808-863
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017951   Gene: ENSSSCG00000016943   Transcript: ENSSSCT00000018451
Sequence length 963
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:46990247:47281159:-1 gene:ENSSSCG00000016943 transcript:ENSSSCT00000018451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGVIATEDEEYFIEPLKNTTEDSKYFSYENGHPHVIYKKSTLQQRHLYDHSHCGVSDLIR
NGKPWWLNDTSAFPSSIPFNGTHMHQRQKRSVSIERFVETLVVADKMMVGYHGRKDIEHY
ILSVMNIVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILS
HQSDGNTIPENGIAHHDNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIG
LGSAFTIAHEIGHNFGMNHDGIGNSCGTKGHEAAKLMAAHITANTNPFSWSACSRDYITS
FLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQCRFQYGATSRQCKYGEVCRELWCLS
KSNRCVTNSIPAAEGTLCQTGNIEKGWCYQGDCVPFGTWPQSVDGGWGPWSLWGECSRTC
GGGVSSSLRHCDSPAPSGGGKYCLGERKRYRSCNTDPCPLGARDFREKQCADFDNMPFRG
KYYNWKPYTGGGVKPCALNCLAEGYNFYTERAPAVIDGTQCNADSLDICINGECKHVGCD
NILGSDAREDRCRVCGGDGSTCDAIEGFFNDSLPRGGYMEVVQIPRGSVHIEVREIAMSK
NYIALKSEGDDYYINGAWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVL
LQEQNLGIRYKFNVPITRTGSGDNEVGFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNS
IVQNNYCDPDSKPPENQRTCNTEPCPPEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSE
EETLDFSGCLTHRPIEKEPCNNQSCPPQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKT
FPAAQCSEESKPPVRIRCSLGRCPPPRWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASS
DCPETARPPSMQQCESKCDSTPISSTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTC
QGH
Download sequence
Identical sequences ENSSSCP00000017951 ENSSSCP00000017951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]