SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018024 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018024
Domain Number 1 Region: 87-301
Classification Level Classification E-value
Superfamily L domain-like 1.36e-41
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 959-1149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-39
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 321-527
Classification Level Classification E-value
Superfamily L domain-like 5.67e-38
Family Ngr ectodomain-like 0.0000282
Further Details:      
 
Domain Number 4 Region: 567-703
Classification Level Classification E-value
Superfamily L domain-like 5.83e-34
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 5 Region: 801-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000138
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 6 Region: 2-61
Classification Level Classification E-value
Superfamily L domain-like 0.000000000381
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 7 Region: 772-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 730-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000318
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 9 Region: 1233-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000779
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1186-1223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018024
Domain Number - Region: 1152-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000807
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018024   Gene: ENSSSCG00000017012   Transcript: ENSSSCT00000018524
Sequence length 1340
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:59626376:59790441:1 gene:ENSSSCG00000017012 transcript:ENSSSCT00000018524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQFTLCMAPV
HLRGFNVADVQKKEYVCPGPHSEPPSCNANSISCPSACTCSNNIVDCRGKGLTEIPANLP
EGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAADAFQGLKSLTSLVLYGNK
ITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPL
QAIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS
GNQDSQYRHLLVADVGSDFLCPDKCRCEGTIVDCSNQKLARVPSHLPEYVTDLRLNDNEI
SVLEATGVFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRMFRGL
SGLKTLMLRSNLISCVSNDTFVGLSSVRLLSLYDNRISTITPGAFTTLVSLSTINLLSNP
FNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCEEGNDESSCQLGP
RCPEQCTCVETVVRCSNRGLRALPRGIPKDVTELYLEGNHLTAVPRELSIFRHLTLIDLS
NNSIGMLTNYTFSNMSHLSTLILSYNRLRCIPIHSFNGLRSLRVLTLHGNDISSVPEGSF
NDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRF
QCKGPVDINIAAKCNACLSSPCKNNGTCSQDPVELYRCACPYGYKGKDCTVPINTCIQNP
CQHGGTCHLSESHQDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCVCP
PNYTGELCDEVIDHCVPGMNLCQHEAKCVSLDRGFRCDCPPGYSGKLCEVDNDDCTAHRC
RHGAQCVDAVNGYTCICPQGFSGLFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQEPTC
RCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDP
LALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLG
KLQKQPAVSINSPLYLGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPP
QALGVSPGCKSCSVCKHGLCRAVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCNQGKCV
ASGTSYVCKCAEGYGGALCDHKNDSASACSAFKCHHGQCHVSDRGEPYCLCQPGFSGEHC
EQESPCLGEVVRDVIRRQKGSASCATASKVPVMECRGGCGPQCCQPTRSKRRKYVFQCTD
GSSFVEEVERHLECGCRPCS
Download sequence
Identical sequences ENSSSCP00000018024 ENSSSCP00000018024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]