SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018099 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018099
Domain Number 1 Region: 3318-3429
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-29
Family Cadherin 0.00066
Further Details:      
 
Domain Number 2 Region: 1124-1251
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 3767-3948
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-28
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 4 Region: 3008-3116
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-28
Family Cadherin 0.00081
Further Details:      
 
Domain Number 5 Region: 2268-2373
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 2793-2901
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 1017-1135
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-26
Family Cadherin 0.00078
Further Details:      
 
Domain Number 8 Region: 2060-2167
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 813-916
Classification Level Classification E-value
Superfamily Cadherin-like 6e-24
Family Cadherin 0.0008
Further Details:      
 
Domain Number 10 Region: 3417-3535
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 3105-3221
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 12 Region: 445-543
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 706-811
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 912-1026
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 15 Region: 2476-2586
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 16 Region: 1229-1337
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-20
Family Cadherin 0.0066
Further Details:      
 
Domain Number 17 Region: 136-226
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 18 Region: 2167-2274
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 19 Region: 2903-3014
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0047
Further Details:      
 
Domain Number 20 Region: 2374-2471
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 21 Region: 1650-1774
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 22 Region: 1754-1874
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 3215-3316
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 24 Region: 2574-2683
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 25 Region: 556-657
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000714
Family Cadherin 0.0028
Further Details:      
 
Domain Number 26 Region: 1437-1531
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000102
Family Cadherin 0.0036
Further Details:      
 
Domain Number 27 Region: 2690-2800
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000118
Family Cadherin 0.0027
Further Details:      
 
Domain Number 28 Region: 1862-1983
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000343
Family Cadherin 0.0052
Further Details:      
 
Domain Number 29 Region: 1348-1430
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000144
Family Cadherin 0.0084
Further Details:      
 
Domain Number 30 Region: 1969-2072
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000585
Family Cadherin 0.0017
Further Details:      
 
Domain Number 31 Region: 1590-1652
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000104
Family Cadherin 0.005
Further Details:      
 
Domain Number 32 Region: 361-457
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000104
Family Cadherin 0.0036
Further Details:      
 
Domain Number 33 Region: 3531-3622
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000327
Family Cadherin 0.018
Further Details:      
 
Domain Number 34 Region: 32-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000328
Family Cadherin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018099   Gene: ENSSSCG00000017084   Transcript: ENSSSCT00000018600
Sequence length 3972
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:77707042:77759843:1 gene:ENSSSCG00000017084 transcript:ENSSSCT00000018600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIALLGFAIFMLHCTTCEKPLEGIISSSAWRFTHPLYNVTIYENSAPKTYVESSEKMGI
YLADPQWAVRYRIISGDVANVFKTEEYVVGNFCFLRIRTKNSNTALLNREVRDSYSLIIQ
ATEKTLEFEALTHVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVSATDADLGQN
AGFYYAFNTRSEMFAIHPTSGVVTLAGKLNVTWRGKYELQVLAVDRMRKISEGNGFGNLA
ALVIHVEPALRRPLAIASVILAAPDSSEDATYATVVVDASSSGVDVDSLEIVGGDPGKNF
KAIKSYARSSEFSLVSVKDINWIEHLHGFNLSLQARGGSRPFYSQIRGFHLPPSKLASLK
FEQAIYRVQLSECSPPGVRVVMVKVTQALANLKYVLKPSSEGAGFKLNARTGLITTTKLV
DFHDRAHYQLEIRTSPSLASTTVVIDIMDCNNHAPMFSKSSYESTFDENIPPGTSVLTIT
ATDKDHGENGYVTYSITRPNAVPFSIDPYLGIISTSKPMDYELMNRIYTFRVRASDWGSP
FRREKEVSVSLRLKNLNDNKPMFEEVNCSGSIHKDWPVGKAVMTVSAIDMDELQNLKYEF
VSGNELDYFDLNHFSGVISLKRPFRNHTTGQPINYSLKITASDGKNYASPMTLNVTIVKD
PRFEVPIKCDKTGVLTHFTKTILHSVGLQNQESNDEDFTSLSAYQINHHTPQFEDHFPQS
IDILESAPLNTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIGLESGLLTIASPLDYE
ATSFYILNVTVYDLGTPQKSSWKVLTVNVEDWNDNAPRFPPGGYQVTVSEDTEVGTTVAQ
LKAKDADSEDNGRVRYTLLSPTEEFSLHPLTGELVVTGHLDRESESQYILKVEARDQPRK
GHQLFSVTDLIVTLEDANDNSPQCITELRRLKVPEDLPPGTILTFLDASDPDLGPAGEVQ
YVLLDDAHGTFHVNPMTGALSLERELDFERRAGYNLSLWASDSGRPIARRTLCHVEVIVL
DVNENLHPPRFASFVHQGQVQENSPSGTSVTVVAAQDDDSGLDGELQYFLRAGTSLSAFS
IHQDTGMIQTVAPLDREFMSCYWLTVQAVDRGSVPLSSVTEVYIEVTDVNDNPPQMSRPV
FYPSVREDAPLHTSVLQLDARDPDSSSKGKLTFNITSGNQMGVFAIHPLTGLLSTARQLD
RENKDEHILEVTVLDNGEPTLRSTSRVVVRILDVNDNPPVFSHKLFNVRLPERLNPVTPG
PVYRLVASDLDEGLNGRVTYSIEESDEEGFSIDPVTGVVSSSSTFTAGEYNILTIKATDS
GQPPLSATVRLHIEWIPQPRPSSIPLAFDESHYSFTVMETDPVNHMVGVISVEGRPGLFW
FSISGGDKDMDFDIEKTMGSIVIAKPLDTRRRSSYNLTVEVTDGSHTIATQVYIFMIANV
NHHRPQFLEASYEVRVPQDTLPGVELLRVQATDQDKGKGLIYTIHGSQDPGSASLFQLDP
SSGVLVTVGKLALGSGPSQHTLTVMVRLGENTLAYGCVWVGTLGGMRTGPFPLLSQSIRY
ERDAETTSPRSHHSLLRHLHLLRATHKEFHTLISSFVSGNSEGFFNINALLGVITLAQKL
DQANHARYTLTVKAEDQGSPQRHDLATVIIHVYPSDSSAPVFSNTEYFVEIPESIPVGSP
VLLISAMSSSEVTYELREGNKNGVFSMNSYSGLISTQKNLDHEKISSYQLKIRGSNMAGA
FTDVMVLVYIIDENDNAPMFSKSTFVGQVSEAAPLNSMIMDENNNPLVIHASDGDTEANS
LLVYKILEPEALKFLKIDPSMGTLTVILEMDYENMPSLRFSIYVHDQGSPILFAPRAAQV
IINIRNVNDCPPRFSDQIYEAAVLQPIHRGMELLMVWASDDDSEVNYSIKSGNADEAVAI
HPVTGRISVLNPAFLGLSRELTIRASDGLYQDTALVKISLTQALNTSLQFDRDVYRATVR
ENLLDRKALVILGAQGNHLNDTLSYFLLNGTDMFHMVKSAGVLQTRGVGFDREQQDTHEV
AVELRDNRTPQRVAQALVRVSIEDVNDNCPEFKHLPYHTIIQDGTEPGDVLFQVSATDQD
LGVNGAITYALAEDYIYFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPSLQTEEE
VLVIVRNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEEPLMLFTT
DFKTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYT
TSVSEGLPAQTPVIHLLASDQDSGQNRDISYHIVEDGSDVSKFFQINGSTGEMSTVQELD
YEAQQHFHVKVRAMDRGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLV
LKVQALDPDSGDTSRLEYLILSGNQDRHFSINSSSGIISMFNLAKKHLASSYNLRVGASD
GVFRATVPVYINTNANKYSPEFQQHVYEAELAENAKVGTKVIELLAIDKDSGPYGTVDYT
IINKLAGEKFSINPSGQITTLQKLDRENSTERVIAIKVMAQDGGGRVAFCTVKIILTDEN
DNPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYSVDSVEDLEEEVIEVNP
TTGVVKVKESLVGLENRAFDLKIKAQDGGPPHWNSLMLLRLQVVPNEVSLPKFSEPLYTF
SASEDLPEGSEIGSVKAVAAQDPVIYSLVQGTTPESNKYGIFSLDQNTGVLKVRKAMDYE
STKWYQIDLMAHCPHNDTYLGSLVSVNIQVKDVNDNRPIFEADPYKAVLTENMPVGTSVI
QVTANDQDTGNDGHVSYRLPVDPGSNIHELFAIDSETGWITTLQELDCETSQIYRFYVVA
HDHGQTIQLSSQVLVEVSITDENDNAPRFASEDYRGSVVENSEPGEPVATLKTLDADIAE
QNRQVTCYITEGDPLGQFGISQVGDEWRIFARKTLDREHMAKYLLRVTASDGKFQASVLV
EIFVLDLNDNSPQCSQLLYTGKVSEDVPLGHFILKISATDLDSDTNAQITYSLHGPGADD
FKLDPHTGELITLTALDREKKDVYSLVAKATDGGGQSCQADVTLHVEDVNDNAPRFFPSH
CAVAVFDNTTVKTPVAVVLARDPDQGTNAQVVYSLTDSAEGHFSIEATTGVIRLEKPLRV
RPKAALELTVRASDLGTPIPLSTLGTVTISVVGLDDYLPVFLSTEHSVQVPEDAQRGTEV
LQLATLTRPGAEKTSYRVVSGNEQGRFRLDARTGILYVNKSLDFETSPKYFLSIECSRKG
SSSLSDMTTIVVNVTDINEHRPRFSQDLYSTRVSENAIVGDLVLTVSATDEDGPLNSAIT
YSLVGGNQLGHFAIHPKKGELQVAKTLDWEQISSYSLRLRATDNGQPPLHEDTDVAIQVV
DVNDNPPRFFQLNYSTSVQENSPTGSKVLQLILSDPDSPENGPPYSFRITQGNDGSAFQV
TPDGWLVTTEGLSKRVQEWYQLQIEVSDSGTPPLSSSTSVRVHVREQSHFPPSALPLEIF
ITLGEEEFQGGMVGKIHATDRDPQDTLTYSLAGEESLAGHFSVGASDGKIIAAQGLPQGR
YVFNVTVSDGTFSTSARVHVHVWHAGREALQQTMWMGFPQLTPEELVSDHWRGLQRFLSN
KLDIKRANIHLASLQPAEATAGVDVLLVFEGHSGTTYKLQELASVITRSAKEMERSVGIQ
MRSAMPVVPCQGPSCQGQICQETVHLDPRVGPTYSTARLSILTPRHRLERNCSCNGTAAR
FSGQSFWRYSLPKAQNWHIRFRLTTLQSQAILLFSNKTAWLSLKLVDGELRLEYRCPGGF
DGNLSSRVHVNDQEWHSVLVEVTDTSIRLLVDSTGTAFLVLPETCQGLRPEGDLFLGGLV
LSHSSPNVSQGFEGCLDAVVINGEALELLAHGKKAAGLLERRALTPCCFHGRECSQNPCL
NGGKCTQTHGAG
Download sequence
Identical sequences ENSSSCP00000018099 ENSSSCP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]