SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018112 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018112
Domain Number 1 Region: 40-489
Classification Level Classification E-value
Superfamily Sema domain 3.4e-138
Family Sema domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 840-898
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.83e-17
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 599-656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.94e-17
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 785-841
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000209
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 5 Region: 899-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 655-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018112   Gene: ENSSSCG00000017095   Transcript: ENSSSCT00000018613
Sequence length 1077
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:78913410:79294356:1 gene:ENSSSCG00000017095 transcript:ENSSSCT00000018613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGPCIIAWLFSSLGWWRLAQPETDASQCQRAEHPVISYKEIGPWLREFRAKNAVDFSQL
TFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKTKEECQNYIRVL
LVGGDRLFTCGTNAFTPVCTNRTLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYA
ATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEHD
CGKTVFSRAARVCKNDLGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQGTFFLPELD
LIYAVFSTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTVD
QGLYVNLTERNLQDAQKFILMHEVVQPVTAVPSFMEDNSRFSHVAVDVVQGRDALVHIIY
LATDYGSIKKVRAPLTQSSGGCLLEEIELFPERRPEPIRSLQILHSQSVLFVGLREHVAK
IPLKRCQFYRTRRLPCVSAQLEGAGWISSSAKCVHSITSSLCASQWDLGIAMCITRNMFV
RGQCGFWDRWRYSAPTASCSGSPPGSCISSSPHPSHSRGPGPQCRCWNHILKHQQKDQCQ
LDGMWSCWSPWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPAAE
SWSEWSDWSECDVSGVQIRVRQCFSGPFCRKWSEEYQPCNTNPCPELKKTTPWTPWTPVN
ISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGR
YSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRLCNNPEPKYGGLPCLGPSLEYQECNILP
CPVDGMWSCWSPWSKCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPE
SWSEWSDWSECDVSGVQIRVRQCVLLYPVGGQCSGNTTESRPCVFDSNFIPEVSVARSSS
IEEKRCGEFSVFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVAPAPLNTS
ITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences ENSSSCP00000018112 ENSSSCP00000018112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]