SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018126 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018126
Domain Number 1 Region: 291-497
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-53
Family Reprolysin-like 0.00051
Further Details:      
 
Domain Number 2 Region: 587-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.37e-16
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1133-1184
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 925-990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 993-1051
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 1057-1118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018126
Domain Number - Region: 881-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0068
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018126   Gene: ENSSSCG00000017109   Transcript: ENSSSCT00000018627
Sequence length 1228
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:82630444:82792519:-1 gene:ENSSSCG00000017109 transcript:ENSSSCT00000018627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAMRAPGCTALWVLLLVGVQQAPACAVGPAAASPGSPSVQRSPGPAEWPGWVEKGEYDL
VSPYEVDRNGDYVSHDISHPQRRKRALAQLGVGSLHLRLQGFRQDFHMDLETSSKLVAPG
FLIQTLGKRGTKSVQPLLPEDFCFYQGSLRSHKNSSVALSTCGGLSGMIRTQEADYFLKP
LPSHLAGRLRASAEGTPPSHILYKRSTEPQGPEPPQMARSQKKWDLENRHLQHQHPPLRG
GASPRHLQKQHFCGRRKKYMPKPPREDLFVLPDEYTSRSRHRRSLLKSHRNQELTVETLV
VVDRKMMQNHGPENITTYVLTVLNMVSALFKDGTIGGNINVAVVGLILLEEEQPGLVISH
HADHTLSSFCRWQSGLMGQDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRS
CTVNEDTGLGLAFTIAHESGHNFGMVHDGEGNVCKKSEGNIMSPTLAGRNGVFSWSACSR
QYLHKFLSTAQAICLADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKVCMLDFKKD
ICKALWCHRIGRKCETKFMPAAEGTVCGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSPWS
PCSRTCGGGVSHRDRLCTNPSPSHGGKFCVGSTRTLKLCNSQKCPRDSVDFRAVQCAEYN
SKRFRGWRYKWKPYTHVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGI
CERVGCDNVLGSDAVEDSCGVCRGNNSSCTMHKGLYAKQHRTNQYYQVVSIPAGARSIRI
YEVNVSTSYISVRNTLKKYYLNGHWMVDWPGRYKFSGSSFNYRRSYKEPETLTSPGPTNE
TLIVELLFQGRNPGIAWEYSVPRLGSEKKLRAQPSYTWATIRSECSVSCGGGHMTTRGAC
YRDLRFPVNASFCSPDARPVTGVTPCKVSACPPSWSVGNWSTCSRTCGGGTQSRPVQCMR
RAHYKSERVPASLCPKPMPSSRQTCHTQSCPPAWSTGPWAECSRTCGKGWRKRSVACKST
NPSARAQLLPDAVCTSEPKPRTHEACLFKRCHKHRKLQWLVSAWSQCSATCERGTQRRFL
KCAEKYVSGKYQELASKKCLHLPQPHLELERVCALFPCPKHPLFPAAGPPRASWSASPWS
QCTASCGGGVQTRSVQCLAGGRPASGCFVQQKPAASQACNTHFCPVAKKRGASCEDRTPW
CSLVPQHGLCSHPSYGPQCCRTCSSSNL
Download sequence
Identical sequences ENSSSCP00000018126 ENSSSCP00000018126 9823.ENSSSCP00000018126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]