SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018163 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018163
Domain Number 1 Region: 229-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-42
Family Pentraxin (pentaxin) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018163   Gene: ENSSSCG00000017144   Transcript: ENSSSCT00000018664
Sequence length 432
Comment pep:known chromosome:Sscrofa10.2:12:1938599:1944323:1 gene:ENSSSCG00000017144 transcript:ENSSSCT00000018664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGPAARTCALLALCLLGSGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQ
LRETVLQQKETILSQKETIRELTTKLGRCESQSTLDASAGEARAGGGRKQPGSGKNTMGD
LSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSR
VNTLEEGKGGPRNDTEERVKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKATAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICITWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVISWAESHIEIYGGA
TKWTFEACRQIN
Download sequence
Identical sequences ENSSSCP00000018163 ENSSSCP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]