SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018188 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018188
Domain Number 1 Region: 125-430
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.26e-89
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018188   Gene: ENSSSCG00000017165   Transcript: ENSSSCT00000018689
Sequence length 1121
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:3353931:3388494:1 gene:ENSSSCG00000017165 transcript:ENSSSCT00000018689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIVDKLKEALKPGRRDSADDGELGRLLASSAKKVLLQKLEFEPASKSFSYQLESLKSKY
VLLNPRPEGAGCPKSGGEPPGAGSGCHRSWGGELASDGDGDGVPAPQKVLFPGERLSLRW
GRVYRVGAGLHNLGNTCFLNSTVQCLTYTPPLANYLLSREHTRGCHQGSFCMLCVMQNHI
VQAFANSGNAIKPVSFIRDLRKIARHFRFGNQEDAHEFLRYTIDAMQKACLSGCAKLDRQ
TQATTLVHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAANIVRALELFVKPDVL
SGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKEVGYPEFLNIRPY
MSQSNGEPVLYGLYAVLVHSGYSCHAGHYYCYVKASSGQWYQMNDSLVHASNIKVVLNQQ
AYVLFYLRIPGSKKSPQGSISRTASSLPGCPGAALDHVKKSVSNGPASSPPAGKRPDPAM
MKKPQTPEELGVPVARNGSVSGLKPQNGYAPPKPPVGSPSPKLSKTPTHAPTLLEEPGKK
VKKPAPPPPLSPPPRPSQGPRGAGEPGGSRGEGRGPGPWGGKASLSPSPRPLAPGTANGL
GPQAGDGGSAAERRGSGGSSPERSAGSGPARNPQAPQGGSTHLCESQGTPSRGPPAQEDA
RLAKAKCPILSGAAPEPANTMSPPPAKKLALSAKKASTLRRAASSDLRPPPLSPSSDLTH
PRKPAHPAAASTWPRSTIRAVSPAPRPSSHLKPPLGPRPPSLPSSPQPLRTSDPQSCSSA
SAPLPQVNGGFQAPPHQPPEASEPPQSPCKKKRKPCMAETEDQGCETCTAAAAPPGKRRR
RKRKHTGDVAASSPAPQEGLLQGQPWSPKRRKEGRPEPPADRWEEEGGQQQGKRWRLGSS
GWPGGCVSDSHQVNSRKRRRKGAEGLGGEALARDPPRRGNCSLSDAVLPETTAASPRKKK
KKKRKEESQQHTDENQSTGQRGRSAAVPGSLLLLAMNGQGPGEPTGLGQTPLVSWDGEKE
SDVVQELLKYSSDKAYGRRVLTWDGEVSAVSRDAVQDSRLARAATVIDDWDEAFDRGKEK
KVKKFKREKKRNFNAFQKLQSRRNFWSVTHPAKAASLSHRR
Download sequence
Identical sequences ENSSSCP00000018188 9823.ENSSSCP00000018188 ENSSSCP00000018188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]