SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018222 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018222
Domain Number 1 Region: 428-584
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-25
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 8.72e-17
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 178-240
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000336
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018222   Gene: ENSSSCG00000017199   Transcript: ENSSSCT00000018724
Sequence length 646
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:5492062:5496460:1 gene:ENSSSCG00000017199 transcript:ENSSSCT00000018724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGWPFSCPICLEPLREPVTLPCGHNFCLACLSALWPHRGAGGAGGPGGTARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPTPAAALAPEPAAPSAPPSSPPSAPEPS
APSAPEPWPEGEEPVRCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVP
PLRRLEESLCPRHLRPLERYCRADRVCLCETCAAQEHRGHELVPLEQERALQEAEQPKVL
SAVEDRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFAEAAAVLQRFQTEVLGFIDEG
EATMLGHSQGDLRRQEDQRSRLSQARHNLSQVPEADSVSFLQELLALRLALEEGCGPGPA
PPRELSFTKSSQAVRKVRDVLASACTSQWEQLQGLGSDEDGLQKPGTEAETETQDPDSTN
SLESEAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVL
GEGALDRGTYYWEVEIIEGWVSVGVMAEDFSPLEPYDRGRLGRNAHSCCLQWNGRSFSVW
FHGLEAALPHPFSPTVGICLEYADRALAFYAVQDGKMSLLRRLKASRARRTGTPASPVDP
FQSRLDSHFAGLFTRRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences F1RVZ0
ENSSSCP00000018222 9823.ENSSSCP00000018222 XP_003131238.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]