SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018224 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018224
Domain Number 1 Region: 290-320
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000053
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018224
Domain Number - Region: 650-723
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 213-244
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00667
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 266-315,758-805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 90-112
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0057
Further Details:      
 
Domain Number - Region: 121-157
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018224   Gene: ENSSSCG00000017201   Transcript: ENSSSCT00000018726
Sequence length 811
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:5540533:5574537:-1 gene:ENSSSCG00000017201 transcript:ENSSSCT00000018726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLGDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER
EDQVGAEYLKNLKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPVGSPLTSSISSSITSS
LAATPPSPAGTSSVPGMNANALPFYPASDTVESVIESALDDLDLNEFGVAALEKTFDSSS
VPHPGSITVGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLAGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANG
TIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDAMEAQVKKLQEELER
LHSGPDPQALPAFSDLETLSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQNRAV
LPCQHAVLCELCAEGSECPVCQPGRAHTLQS
Download sequence
Identical sequences ENSSSCP00000018224 ENSSSCP00000018224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]