SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018252 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018252
Domain Number 1 Region: 140-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-56
Family C-terminal domain of adrenodoxin reductase-like 0.0000000033
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.18e-19
Family N-terminal domain of adrenodoxin reductase-like 0.000004
Further Details:      
 
Domain Number 3 Region: 341-491
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000647
Family N-terminal domain of adrenodoxin reductase-like 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018252   Gene: ENSSSCG00000017227   Transcript: ENSSSCT00000018754
Sequence length 492
Comment pep:known chromosome:Sscrofa10.2:12:6362554:6373263:1 gene:ENSSSCG00000017227 transcript:ENSSSCT00000018754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRCWRWWHWSAWPRTRPPPSGSTQSFRQQFSTQEQTPQICVVGSGPAGFYTAQHLLKH
HSRARVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFHGNVVVGRDVTV
PELQEAYHAVVLSYGAEDHRALEIPGEELPGVFSARAFVGWYNGLPENQELAPDLSCDTA
VILGQGNVALDVARILLTPPEHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPILDPADFLGLQDRIKEVPRPRKRLMELLLRTATEKPGAEEAARRASA
SRAWGLRFSRSPQQVLPSADGRRAAGIRLAVTRLEGVGEATRAVPTGDVEDLPCGLVLSS
IGYKSRPIDPSVPFDLKLGVIPNTEGRVVDMPGLYCSGWVKRGPTGVITTTMTDSFLTGQ
MLLQDLKAGLLPSGPRPGYAAIKALLSSRGVWPISFSDWEKLDAEEVSRGQGAGKPREKL
LDPQEMLRLLGR
Download sequence
Identical sequences F1RV70
ENSSSCP00000018252 ENSSSCP00000018252 9823.ENSSSCP00000018252 NP_001231656.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]