SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018254 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018254
Domain Number 1 Region: 645-773
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.04e-23
Family Phosphate binding protein-like 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018254   Gene: ENSSSCG00000017229   Transcript: ENSSSCT00000018756
Sequence length 1208
Comment pep:novel chromosome:Sscrofa10.2:12:6378936:6391650:1 gene:ENSSSCG00000017229 transcript:ENSSSCT00000018756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGALGPALLLTSLLGAWAGPGPGQGEQALTVAVVFGSSGLPQAQARIRLTPQSFLDLPL
EIQPLTVGVNNTNPSSLLTQICGLLGAAHVHGIVFEDNVGTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKVPVHSRAPTSLEPGAGLGLVESGPEGVIALPAAGHRVGHAAASARIR
ALHDDKRSLFQRGHRQVPAVHHGLQGGAVARPHRILHVENAMVPAPHLQRDRAEPGAGTF
GQQESWGKGLAWLFPLLKTTLISAPSLYSHNALQTFLLQQWSPQILLVFMFSGTAVSYSS
AEGEVPALPGDIDLHPCPGPDAPSPHNRLRRQLSVTTLMRPTGKTAGGASVLPRARLGTS
HTCPGPTRPACAASAKSTSASSPPAAAAPGTRPAAGRRSPVPGGGAGLWITISHRNSFSC
AITFHTRIPVFSVDMCRAAXEDIHASFDLIRKSPLLGQLPSTRPHASCWDLVVVLAFPEH
PVLRSDGAGGWERKGKKLGRRPSLVKGSGGKREMRARGHVASPGGFLEPYSPAVWVMMFV
MCLTVVAITVFTFEYFSPVSYNRNLTSGKKSGGPSFTIGKSVWLLWALVFNNSVPIENPR
GTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFG
TVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDE
GCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQFLGDGETQKLETVWLSGICQNE
KNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWKLRHSVPNTSRLDFLLAFSR
GIYSCFSGVQSLASPARPPSPDVTASSAQASVLKMLQAARDMVTSAGVSSSLDRATRTIE
SWGGGGGRRAPPSPACPGPRPPTPSPARDPSPTGRGPPGGSRAALGRRVPQPPGGPPTSE
PSLPDVSRASGWRAREARWPVRAGSGCRRFSASERRALPERPLSPDRCHYSSFPRADRSG
RPFLPLFPEPPEPENLPLLGPEQLARREALLRAAWARGSRPRHASLPSSVAETFARPSSG
PARCARQACGRLTQAQSMRLPSYREACQEAVWAGALAWPHGPHACLHAHAHLPLCWGAVC
PHLPPCVSHGPWLPAAWRPPGHRDRTLGLSTGYRDSGGLEEVSRVACGVHGFPRPCAWRR
ISSLESEV
Download sequence
Identical sequences ENSSSCP00000018254 ENSSSCP00000018254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]