SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018334 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018334
Domain Number 1 Region: 338-468
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-41
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 196-333
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 478-614
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-35
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 4 Region: 789-915
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-33
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 5 Region: 926-1077
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-32
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 622-772
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-28
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 7 Region: 1216-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 3-133
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.69e-25
Family Cysteine rich domain 0.0045
Further Details:      
 
Domain Number 9 Region: 1090-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-24
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 133-191
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018334   Gene: ENSSSCG00000017300   Transcript: ENSSSCT00000018836
Sequence length 1440
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:15951695:15978403:-1 gene:ENSSSCG00000017300 transcript:ENSSSCT00000018836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPSVFLIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWKWVSRNRLFNLGSMQCLGTGWP
GTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGGRTSNTSKAGTPERGDQSRSGQWR
IYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDY
GKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEI
HEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIR
TESSGGWQNRDCSIALPYVCKKKPNATAEPPPPDVWANVKVECEPSWQPFQGHCYRLQAE
KRSWQESKKMCLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGS
LVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSPGTAEEDH
GCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWDGEY
FWTALQDLNSTGSFRWLSGDEVMYTHWNRGQPGYSRGGCVALATGSAMGLWEVKNCTSFR
ARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWSSDPKLRHCYKVFSSERLQDKKSWVQ
AQGACRELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNHRDPGAGQSW
RWSDGLGFSYHNFDRSWHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGADVREP
DDVSPQGRMEWLRFQEAEYQFFEHQSTWVQAQRICTWFQAELASVHSQAELDFLGHNLQK
FSRGQEQHWWIGLHTSENDGRFRWIDGSVINFISWAPGKPRPIGKDKKCVYMTASQANWG
DQRCLTALPYICKRSNSTGDQQPPDPPPTGGCPSGWSQFLNKCFRIQGQDPQDRVKWSEA
QFACEQQEAQLVTIANPLEQAYITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYANWAP
GEPSGPSPAPSGNIPTSCAVVLHSPSAHFTGRWDDRSCMEETHGFICQKGTDPSLSPSPA
ALPPAPGAELSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVPDPYTQAFLTQAARGLR
TPLWIGLASEEGSRRYSWVSEEPLGYVSWQDGEPQHLGGCAYVDVDGTWRTTSCDTKLQG
AMCGVNGGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGG
AVLSILDEMENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLG
PSMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRAEESSFSPSAALPENPAALVVVL
MAVLLLLALLTAALILYRRRQSVERGAFEGARYSRSSSGPGEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences ENSSSCP00000018334 ENSSSCP00000028459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]