SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018415 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018415
Domain Number 1 Region: 262-473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-34
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 72-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-28
Family Laminin G-like module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018415   Gene: ENSSSCG00000017381   Transcript: ENSSSCT00000018920
Sequence length 585
Comment pep:known chromosome:Sscrofa10.2:12:20297154:20307726:1 gene:ENSSSCG00000017381 transcript:ENSSSCT00000018920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLEPGIQRCACGLDRSCVYPALHCNCDADQPQWRTDRGLLTFVDHLPVTQVVVGDTNRS
SSEAQFFLRPLRCYGDRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLEN
MGGPHCQWRRPYVRVELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVK
QARLRVDHRPWVLRPMPLQTYIWLEYDRPLYVGSAELKRRPFIGCLRAMRLNGVTLNLEG
RANASEGTSPNCTGHCAHPRFPCFHGGRCVERYSYYTCDCELTAFDGPYCNHDIGGFFEP
GTWMRYNLQSALRSAAREFSHMLSRPPGYRGPVYNVTGEEVSFSFSTHSAPAVLLYVSSF
VRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTDGQPHSVNITRVYRNLFIQVDYFP
LTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRYNTPGFSGCLSGVRFNNVAPLKT
HFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEVPPELDPWYLPPGDAFSAADFPYY
HDDGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEPK
Download sequence
Identical sequences ENSSSCP00000018415 ENSSSCP00000018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]