SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018428 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018428
Domain Number 1 Region: 86-273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-39
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 276-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.04e-33
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 3 Region: 2-113
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00076
Further Details:      
 
Domain Number 4 Region: 514-571
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000538
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 5 Region: 485-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018428   Gene: ENSSSCG00000017393   Transcript: ENSSSCT00000018933
Sequence length 634
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:20380178:20386591:1 gene:ENSSSCG00000017393 transcript:ENSSSCT00000018933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQQ
GHNSTFFGNVNESGVVRHDLHFHFTARYIRIVPLAWNPRGKIGLRLGIYGCPYKSDVLYF
DGDDAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTLELQGAHLVLHMS
LGSSPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDANLTLDGYVHRFVLNGDFERLNL
DNEMFIGGLVGAAQKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEGKVAFRCLD
PVPHPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSSLGDGLGHVELILSEG
QVNVSIVQTGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIR
TGTSYFFGGCPKPASRWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRRLGYYAEVLFDT
CGITDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGN
FTIDPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAVQYWNASWE
EVSALANASQHCEQWIEFSCYNSRLLNTAGEGWR
Download sequence
Identical sequences ENSSSCP00000018428 ENSSSCP00000018428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]