SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018463 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018463
Domain Number 1 Region: 149-278
Classification Level Classification E-value
Superfamily FKBP-like 6.61e-40
Family FKBP immunophilin/proline isomerase 0.00032
Further Details:      
 
Domain Number 2 Region: 42-154
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 266-305
Classification Level Classification E-value
Superfamily FKBP-like 0.00001
Family FKBP immunophilin/proline isomerase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018463   Gene: ENSSSCG00000017422   Transcript: ENSSSCT00000018968
Sequence length 309
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:21195504:21201361:1 gene:ENSSSCG00000017422 transcript:ENSSSCT00000018968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRAGPPSHTLRRLPLLQLLLLAQALGRGLGRANPAGGPLEDVVIERYHIPRVCPREVQM
GDFVRYHYNGTFEDGKKFDSSYDRHTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPP
HLGYGSIGVAGLIPPDATLYFDVVLLDVWNKADTVQVTTLLRPPHCPRMVQDSDFVRYHY
NGTLLDGTAFDTSYSRGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEKG
YGTVIPPQASLVFHVLLIDVHNPKDTVQLETLELPPGCVRRAVAGDFMRYHYNGSLMDGT
LFDSRSGAS
Download sequence
Identical sequences ENSSSCP00000018463 ENSSSCP00000018463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]