SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018480 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018480
Domain Number 1 Region: 346-417
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.63e-23
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 106-141
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000209
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018480
Domain Number - Region: 13-68,402-458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000243
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 218-331
Classification Level Classification E-value
Superfamily Prefoldin 0.00133
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018480   Gene: ENSSSCG00000017439   Transcript: ENSSSCT00000018985
Sequence length 460
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:21433477:21441665:-1 gene:ENSSSCG00000017439 transcript:ENSSSCT00000018985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKCSPASIKSCPRPSSVCSSSTSCRPELCLGYVCQPMTCVPSLCMPTTYRPASCLSKV
YMAGSCRPSSCHLISGISSSLGSYSSVGSYSSVGTYGGYHEGSFNGNEKETLQFLNDRLA
KYLEKVRQLEQDNAELESKIQEASQSQVPTLSSNYHSYFRTIEELQQKILCTRAENARTI
VHMDNAKLAADDFRTKYETELAMRQLVEADTNGLRRILDELTLCKADLEMQVESLKEELM
CLKKNHEEEVGALQGQLGDRLNIEVDAAPPVDLNRVLEEMRCQYEALVESNRRDVEEWFT
MQMEELNQQVATSSEQLQSYQSDAIDLRRTVNMLEIELQAQHSLRDSLENTLTETEARYS
SQLAQVQGLIGNVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDCKLP
CNPCSTASCPQSASSSSAPRPVGVPCTVCVPGMPCPQGRF
Download sequence
Identical sequences ENSSSCP00000018480 ENSSSCP00000018480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]