SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018516 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018516
Domain Number 1 Region: 25-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-23
Family Growth factor receptor domain 0.00000253
Further Details:      
 
Domain Number 2 Region: 170-253
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.76e-23
Family Thyroglobulin type-1 domain 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018516   Gene: ENSSSCG00000017472   Transcript: ENSSSCT00000019021
Sequence length 259
Comment pep:known chromosome:Sscrofa10.2:12:22275243:22290067:-1 gene:ENSSSCG00000017472 transcript:ENSSSCT00000019021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLCLVAALLLLASGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATC
ALGKGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGLCMELAEIEAIQESLQPSDKD
EGDHPNNSFSPCSPQDRRCLQKHLAKIRDRSTSGGKMKVIGAPREEARPVPQGSCQSELH
RALERLAASQRRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPG
GLEPKGELDCHQLADSFRE
Download sequence
Identical sequences E9KYT3
9823.ENSSSCP00000018516 ENSSSCP00000018516 ENSSSCP00000018516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]