SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018545 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018545
Domain Number 1 Region: 692-971
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-69
Family Protein kinases, catalytic subunit 0.0000000017
Further Details:      
 
Domain Number 2 Region: 313-500
Classification Level Classification E-value
Superfamily L domain-like 3.4e-41
Family L domain 0.000000261
Further Details:      
 
Domain Number 3 Region: 1-149
Classification Level Classification E-value
Superfamily L domain-like 1.73e-40
Family L domain 0.000000281
Further Details:      
 
Domain Number 4 Region: 487-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.37e-20
Family Growth factor receptor domain 0.000000245
Further Details:      
 
Domain Number 5 Region: 165-320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.7e-17
Family Growth factor receptor domain 0.0000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018545   Gene: ENSSSCG00000017497   Transcript: ENSSSCT00000019050
Sequence length 1234
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:23049768:23069930:-1 gene:ENSSSCG00000017497 transcript:ENSSSCT00000019050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCTGTDMKLQLPASPETHLDMLRHLYQGCQVVQGNLELTYLPANANLFFLQEIQEVQGYV
LIAHNRVSWVPLQRLRIVRGTQLFEDRYALAVLDNGDLLESATPAAGAAAEGLQELQLQS
LTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNPLTTVAVEANRSRACPPCSPACKASHC
WGESSKDCQSLTRTICAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACFHFNHSGIC
ELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPPNNQEVTA
EDGTQRCEKCSKPCAQVCYGLGIEHLREVRAVTSANIQEFAGCRKIFGSLAFLPESFEGD
PASSTAPLQPEQLRVFETLEEITGYLYISAWPDSLPDLSVFQNLRVIRGRVLHDGAYSLT
LQGLGISSLGLRSLRELGSGLALIHRNARLCFVHTVPWDQLFRNPHQALLHSANRPEEEC
VGEGLTCYQLCAHGHCWGPGPTQCVNCSQFLRGQECVKECRVQQGHPREYVKDRYCLPCH
PECQPQNGSDTCFGSEADQCVACAHYKDPPFCVARCPSGVKPDLSFMPIWKFPDEDGMCQ
PCPINCTHSCVDLDDKGCPAEQRASPASSIIAGVVGVLLAAVIGVVFGTLIKRRRQKIRK
YTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKVRGGAKVR
GGRSQRTRAQLDVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLM
PYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKI
TDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAK
PYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVAEFSRMAR
DPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGG
TAHRRHRSTSTRSGGGELTLGLEASEEEPPKSPLAPSEGAGSDVFDGDLGMGAAKGLQNL
PQHDSSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYVNQPEVRPQPPSPLEGPLPPPR
PTGATLERPKTLSPGRNGVVKDVFAFGAAVENPEYLAPRGRAPSQNHPSPAFSPAFDNLY
YWDQDPSDRGALPSTFEGTPTAENPEYLGLDVPV
Download sequence
Identical sequences ENSSSCP00000018545 ENSSSCP00000018545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]