SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018739 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018739
Domain Number 1 Region: 17-100,290-351
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.61e-47
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018739   Gene: ENSSSCG00000017685   Transcript: ENSSSCT00000019249
Sequence length 389
Comment pep:novel chromosome:Sscrofa10.2:12:39526044:39533556:1 gene:ENSSSCG00000017685 transcript:ENSSSCT00000019249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLP
PILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALCQRKPLTPQGDDLSEP
RVAAGEVKRGDAQNSAGEDDVLLSKSPSSLSANVISSPKGSPSSSRKSGASCPSSKNSSP
NSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDTSRENGAGQVCELADNLSRGHMLGGSQ
PELVTPQDHEVALANGFLYEHEACGNGYSNGQLENHSEEDSTDDQREESRVKPIYNLYAI
SCHSGILGGGHYVTYAKNPNSKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDYAQFL
PKIDGKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences ENSSSCP00000018739 ENSSSCP00000018739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]