SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018755 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018755
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.58e-26
Family Ribosomal L11/L12e N-terminal domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 77-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000563
Family Ribosomal protein L11, C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018755   Gene: ENSSSCG00000017699   Transcript: ENSSSCT00000019265
Sequence length 158
Comment pep:novel chromosome:Sscrofa10.2:12:41054138:41054634:1 gene:ENSSSCG00000017699 transcript:ENSSSCT00000019265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPKFDPNKIKVIYLRCTGGEDGAPSALAPTIGPLGLSPKKVGDDVAKATGDCKGLRIIV
KLTIQNRQAQIEVVASASALPIKALKELPRERKQQKNIKHNGYITFDEIVNIDRQMGELS
GAIKEILGTAQSVGCDVAGCHHAIIDDINSGAMQSPAS
Download sequence
Identical sequences ENSSSCP00000018755 ENSSSCP00000018755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]